KEGG   Bordetella genomosp. 13: CAL15_12845Help
Entry
CAL15_12845       CDS       T05441                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K10548  putative multiple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
bgm  Bordetella genomosp. 13
Pathway
bgm02010  ABC transporters
Module
bgm_M00216  Multiple sugar transport system
Brite
KEGG Orthology (KO) [BR:bgm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CAL15_12845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgm02000]
    CAL15_12845
Enzymes [BR:bgm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     CAL15_12845
Transporters [BR:bgm02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Multiple sugar transporter [MD:M00216]
    CAL15_12845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N ABC_ATPase RsgA_GTPase AAA_23 AAA_22 AAA_30 AAA_27 Rad17 DUF2813 AAA_15
Motif
Other DBs
NCBI-ProteinID: ARP95191
UniProt: A0A1W6ZCV0
Position
complement(2851730..2853265)
Genome map
AA seq 511 aa AA seqDB search
MAYLLEMRAITKTFPGVKALNRVSLAVRQGEIHAICGENGAGKSTLMKVLSGVYPHGSYD
GDIVYDGEVVRFRSIRDSESRGIVIIHQELALVPQLSIAENLFLGNERAAGGVISWHETF
RQAGALLCKVGLADPPGTVVGTLGVGKQQLVEIAKALSKDVRLLILDEPTAALSEADSQA
LLDLLLGLKAQGITSIIISHKLNEVRRVADRVSVIRDGTTVSTLDAEAGPLCEDRIVRDM
VGRDLSQRYPPRERRAGAAVFEVRDWNVWHPRQPGRQMIRSVSLTVRAAEVVGIAGLMGA
GRTELALSLFGRSYGRDISGEVRVRGRPVDVSDVPRAIEAGMAYVTEDRKSLGLLLEDSL
LRNVTLAGLRRVSRAGVLDRRREIAVAERYQAAMRIRTPSVFQKVGHLSGGNQQKVVLSK
WLFTEPDVLILDEPTRGIDVGAKYEIYGIINELSAQGKAVLMISSELPELLGMCDRIYVM
NEGAFVGELDAEQATQERIMSLIVRDQEQAA
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcctatctgctcgagatgcgcgccatcacgaagacctttccgggcgtgaaggcgctg
aaccgggtcagcctcgccgtcaggcagggcgagattcatgcgatctgcggcgagaacggc
gccggaaagtccacgctgatgaaggtgctgtcgggcgtatacccccacggctcctacgac
ggcgatatcgtctacgacggcgaggtcgtgcgctttcgctcgatccgcgacagcgagtcg
cgcggcatcgtcatcatccatcaagagctcgcgctggtgccccagttgtcgatcgccgag
aaccttttcctcggcaacgagcgggcggcgggcggcgtgatctcgtggcacgagacgttc
cgccaggccggcgcgctgttgtgcaaggtcggactggccgacccgcccggcaccgtggtc
ggcacgctgggcgtgggcaagcagcaactggtggaaatcgccaaggcgctgtccaaggac
gtgcggctgctcatcctggacgagcccacggcggcattgtccgaagccgacagccaggcc
ttgctcgacttgctgctggggctgaaggcgcagggaatcacgtcgatcatcatcagccac
aagctgaacgaggtgcggcgcgtcgccgaccgcgtcagcgtgatacgggacggcacgacc
gtctcgaccctggacgccgaggcggggccactgtgcgaggatcgcatcgttcgcgacatg
gtggggcgcgacctgtcgcagcgctatccgccgcgcgagcgccgggccggcgcagcggtg
ttcgaggtgcgcgactggaacgtctggcaccccaggcaacccggccggcagatgatccgc
agcgtctcgctcaccgtgcgcgcggcggaggtcgtgggcatcgccgggctgatgggggcc
ggccgcaccgagcttgccctgtcgctgttcgggcgcagctacggccgcgacatctcgggc
gaggtgcgggtgcggggacggccggtcgacgtatcggacgtgccccgcgccatcgaggcc
ggcatggcctacgtcaccgaggaccgcaagtcgctgggtctgctgctggaggattcgctg
ttgcgcaacgtgacgctggccggactgcggcgggtgtcgcgggccggcgtactcgatcgc
cgccgcgagattgcggtggccgagaggtaccaggccgccatgcgcattcgcacgccctcg
gtattccagaaggtgggccatctgtcgggcggcaatcagcagaaggtggtgctgtccaag
tggctgttcaccgagcccgacgtgctgatcctggacgagcccacgcgcggcatcgacgtg
ggcgcgaagtacgagatttacggaatcatcaatgaactcagcgcccagggcaaggcagtg
ctcatgatttcgtcggagctgccggagctgcttggcatgtgcgaccgcatctacgtgatg
aacgagggcgcgttcgtgggggagctcgatgccgagcaggcgacccaggaacgcatcatg
tcgctcatcgtccgggaccaggagcaggcagcatga

DBGET integrated database retrieval system