KEGG   Bordetella genomosp. 13: CAL15_16350Help
Entry
CAL15_16350       CDS       T05441                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
bgm  Bordetella genomosp. 13
Pathway
bgm00640  Propanoate metabolism
bgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CAL15_16350
Enzymes [BR:bgm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     CAL15_16350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ARP95810
UniProt: A0A1W6ZF93
Position
3655131..3657725
Genome map
AA seq 864 aa AA seqDB search
MNTNYRKPLPGTSLDYFDARQAVEDIQAGAWATLPYTSRVLAENLVRRCDPATLTDSLRQ
LIERRRDLDFPWYPARVVCHDILGQTALVDLAGLRDAIADAGGDPAQINPVVPTQLIVDH
SLAVEYPGFDKDAFEKNRAVEDRRNEDRFHFIDWTKQAFRNVDVIPPGNGIMHQINLEKM
SPVVQVRDGVAFPDTCVGTDSHTPHVDALGVIAIGVGGLEAENVMLGRASWMRLPDIVGV
ELTGRPQPGITCTDIVLALTEFLRREKVVGAYIEFLGAGASALTIGDRATISNMTPEFGA
TAAMFYIDGQTIDYLRLTGRDEDQVRLVETYARQAGLWADDLVRAEYERMLSFDLSSVVR
NMAGPSNPHKRVATTELAARGIAAPWEETPGQMPDGAVIIAAITSCTNTSNPRNVIAAGL
LARNANRAGLVRKPWVKTSLAPGSKAVQLYLEESGLLADLEKLGFGIVAFACTTCNGMSG
ALDPKIQQEIIDRNLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVIAYAIAGTVRVDIE
RDALGVDANGKPVTLKDIWPSDEEIDAVVAASVKPEQFRKVYEPMFRFAVEQETKVSPLY
DWRPQSTYIRRPPYWEGALAGERTLRGMRPLAVLGDNITTDHLSPSNAIMADSAAGEYLA
KMGLPEEDFNSYATHRGDHLTAQRATFANPKLINEMAVVDGQVRQGSLARLEPEGKVMRM
WEAIETYMERKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIVAEGFERIHRTNLIGMG
VLPLEFQPGADRKTLGIDGTETFDVIGERVPRATLTLVIHRRAGAPVHVPVTCRLDTAEE
VSIYEAGGVLQRFAQDFLESTQAA
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgaactaccgcaagcccctgcccggcacctcgctggactatttcgacgcgcgc
caggcggtcgaagacatccaggccggcgcctgggccaccctgccctacacctctcgcgtg
ctggccgagaacctggtgcgccgctgcgatccggccacgctgaccgactcgctgcgccag
ctgatcgaacgccgccgcgacctggattttccgtggtatccggcacgcgtggtctgccac
gacatcctggggcagacggcgctggtcgacctggccggcctgcgcgatgccattgccgat
gccggcggcgacccggcgcagatcaatccggtcgtgcccacccagctcatcgtcgatcac
tcgctggccgtcgagtatccgggcttcgacaaggacgctttcgagaagaaccgcgcggtg
gaagaccgccgcaacgaagaccgcttccatttcatcgactggaccaagcaggcgtttcgc
aacgtcgacgtgatcccgccgggcaacggcatcatgcaccagatcaacctcgagaagatg
tctccggtggtgcaggtgcgcgacggcgtggcgtttccggacacctgcgtgggcaccgac
agccacaccccgcacgtggacgcgctgggcgtgatcgccatcggcgtgggcggcctcgag
gccgagaacgtcatgctggggcgcgcgtcgtggatgcggctgccggacatcgtcggcgtc
gagctcaccggccgtccgcaaccgggcatcacctgcaccgacatcgtgctggcgcttacc
gaattcctgcgccgcgagaaggtggtgggcgcctacatcgagttcctgggcgccggcgcc
agcgcgctcaccatcggcgaccgcgccacgatttccaacatgacgccggaattcggcgcc
accgcggccatgttctacatcgatggccagaccatcgactacctgcggcttacgggtcgc
gacgaggaccaggtgcggctggtggagacctatgcgcggcaggccgggctgtgggccgac
gacctggttcgcgccgagtacgagcgcatgctgagcttcgacctgtcgtcggtcgtgcgc
aacatggccggtccgtcgaacccgcacaagcgcgtggccaccaccgagctggccgcccgc
ggcatcgccgcgccgtgggaagagacgccgggccagatgcccgacggcgccgtcatcatc
gccgccatcaccagctgcaccaacaccagcaacccgcgcaacgtcatcgcggccggcctg
ctggcgcgcaacgcgaaccgggccggactggtgcgcaagccctgggtgaagacctcgctg
gccccgggatccaaggcggtgcagctgtacctggaagaatcgggactgcttgccgacctg
gaaaagctgggcttcggcatcgtggcgttcgcgtgcaccacctgcaacggcatgagcggc
gcgctcgatccgaagatccagcaggagatcatcgaccgcaatctatacgccacggcggta
ctgtcgggcaaccgcaatttcgacggacgcatccatccctacgccaaacaggccttcctg
gcgtcgcccccgctggtcattgcgtacgccatcgcgggcacggtgcgcgtggacatcgag
cgcgacgcgctgggcgtcgatgcgaatggcaagcccgtcacgctgaaggacatctggccc
agcgacgaagaaatcgacgcagtcgtggccgccagcgtgaagcccgagcagttccgcaag
gtctacgagcccatgttccgcttcgccgtcgaacaggaaacgaaggtcagccccttgtac
gactggcgtccgcagagcacctatatccgccgtccgccgtattgggaaggcgcgctggcc
ggcgaacgcacgctcaggggcatgcggccgctggcggtgctgggcgacaacatcaccacc
gaccacctgtcgccgtccaacgcgatcatggccgacagcgccgccggcgaatacctggcg
aagatgggcctgcccgaagaagacttcaactcgtacgccacccatcgcggcgatcacctg
acggcgcagcgagccaccttcgccaaccccaagctgatcaacgagatggccgtggtcgac
ggacaggtcaggcaggggtcgctggcccggctcgagcccgagggcaaggtcatgcgcatg
tgggaagccatcgagacctacatggaacgcaagcagcccctgatcatcatcgcgggcgcc
gactacggccagggctcgtcgcgcgactgggcggccaagggtgtgcggctggccggcgtc
gaggccatcgtcgccgagggcttcgagcgcatccaccgcacgaacctgatcggcatgggg
gtcctgccgctggagttccagcccggcgccgaccgcaagacgctgggcatcgacggcacc
gagaccttcgacgtcatcggcgaacgcgtgccgcgcgccacgctgacgctggtcatccat
cgacgtgcaggcgcaccggtgcacgtgccggtcacctgtcgcctggataccgccgaggaa
gtctcgatctacgaagccggcggcgtgctgcagcgcttcgcgcaggacttcctcgaatcc
acgcaggcggcctga

DBGET integrated database retrieval system