KEGG   Bordetella genomosp. 13: CAL15_16450Help
Entry
CAL15_16450       CDS       T05441                                 

Definition
(GenBank) hypothetical protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
bgm  Bordetella genomosp. 13
Pathway
bgm00930  Caprolactam degradation
Brite
KEGG Orthology (KO) [BR:bgm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CAL15_16450
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bgm01002]
    CAL15_16450
Enzymes [BR:bgm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     CAL15_16450
Peptidases [BR:bgm01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   CAL15_16450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DJ-1_PfpI DUF2069
Motif
Other DBs
NCBI-ProteinID: ARP95828
UniProt: A0A1W6ZEN0
Position
complement(3678459..3679157)
Genome map
AA seq 232 aa AA seqDB search
MTTEPKTRIGMLVFPMVTSLDILGPFEVLARASDCRVELVWKDRQPIKGDTGLAITPDRG
FGDAPQYDVLVVPGGPGQTPMMEDAEVIGFLRRQAPGAGFVTSICTGSLLLAAAGLLAGR
KATCHWLSIDQLALFGVEIVPERVVVDGNRITGAGVTSGLDFAFTVLAAIRGEEEAKALQ
LLMEYDPAPPFQSGHPRVAAPELTEKVRLMARNMLERRLEVSRRVAEAAKQG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgaacccaaaacccgcatcgggatgctcgtcttcccgatggtcacgtcgctg
gacatcctcggcccgttcgaagtgcttgcgcgcgcgtcggactgccgcgtcgaactggtg
tggaaagaccggcaacccatcaagggggacaccggcctggccatcacgccggatcgcggc
ttcggcgatgcgccgcagtacgacgttttggtcgtgccgggcggcccggggcagactccc
atgatggaggatgccgaggtgatcggcttcctgcgcaggcaggcgcccggcgctggattc
gtcacctctatctgcaccggatcgctgctgcttgcggcggcgggattgctggcggggcgc
aaggcgacgtgccattggctgtccatcgaccagcttgcgctgttcggcgtcgagatcgtg
ccggagcgggtggtggtggacggcaatcgcatcacgggcgcgggcgtcacatccggactg
gattttgccttcacggtgctcgccgcgatccgtggcgaggaagaggcgaaggctttgcag
ttgctgatggaatacgatcccgctccgccgttccagagcggacatccccgcgtggcggcg
cccgaactgaccgagaaagtccggctcatggcgcgcaacatgctggagcggcgcctggag
gtttccagacgggtcgccgaggccgcgaagcaaggctga

DBGET integrated database retrieval system