KEGG   Bordetella genomosp. 13: CAL15_16560Help
Entry
CAL15_16560       CDS       T05441                                 

Definition
(GenBank) low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bgm  Bordetella genomosp. 13
Pathway
bgm00260  Glycine, serine and threonine metabolism
bgm01100  Metabolic pathways
bgm01110  Biosynthesis of secondary metabolites
bgm01120  Microbial metabolism in diverse environments
bgm01130  Biosynthesis of antibiotics
bgm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CAL15_16560
Enzymes [BR:bgm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CAL15_16560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 DUF3376 Cys_Met_Meta_PP BAT
Motif
Other DBs
NCBI-ProteinID: ARP95848
UniProt: A0A1W6ZEP9
Position
complement(3702837..3703877)
Genome map
AA seq 346 aa AA seqDB search
MIDLRSDTVTRPTAAMLQAMVQAPLGDDVMGDDPTVQKLQAVVAERAGKEAGLYFPSGTQ
SNLGGLMAHCGRGDEYLVGQQAHTYKYEGGGAAVLASIQPQPVEHAPDGTLPLEKLKAAV
KPDDPHFARTRLLALENTFQGKVIPADYIRQAAAFAREQNLGLHLDGARVFNAAVASGQP
LQAMCEPFDTVSICFSKGLGAPVGSVLVGGKALIDAARRWRKVLGGGMRQSGVLAAACLY
ALEHHVERLAQDHANAERLAAGLSGIQGVRVLSQDTNMVFAEFEPAICEGLTRAMGERGV
LMRAVYGGPTRLVTHLDVSEQDVDRVVAVVREYCGRHVTATSAAAA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacttgcgcagcgataccgtcacccgtcccactgccgcgatgctgcaggccatg
gtgcaggcgcccctgggcgacgacgtgatgggcgacgatccgacggtgcagaagctgcag
gccgtcgtggccgaacgcgccggcaaggaagccggcctgtattttccgtccggcacgcag
agcaacctgggcggcctgatggcgcattgcggccgcggcgacgagtatctggtgggccag
caggcccatacctacaagtacgaaggcgggggcgccgcggtgctggccagcatccagccg
cagcctgtcgaacatgcgcccgacggcacgctgccgctggaaaagctgaaggcggccgtc
aagcctgacgatccgcatttcgcgcgcacgcgcctgctggcgctcgagaatacattccag
ggcaaggtgataccggccgactacatccgccaggccgccgcgttcgcgcgcgagcagaat
ctggggctgcacctggacggcgcgcgcgtgttcaatgcggccgtggccagcggccagccg
ctgcaggcgatgtgcgagccgttcgacacggtctccatctgtttttccaagggcctgggc
gcgccggtcggttcggtgctggtgggaggcaaggcgctgatcgacgcggcgcgccgctgg
cgcaaggtgctggggggcggcatgcgccaatcgggtgtgctggccgcggcctgcctgtat
gcgctggagcatcacgtcgagcgcctggcgcaggaccatgccaacgccgagcgcctggcc
gccggcctgtccggtatccagggtgtccgcgtgctctcgcaggacacgaacatggtgttc
gcggagttcgagcccgccatctgcgaaggcctgacgcgcgcgatgggcgagcggggcgtc
cttatgcgggcggtgtatggcggaccgacgcgcctggtcacgcatctggacgtatccgaa
caggatgtggatcgcgtggtggcggtggtgcgcgagtactgcggccgccatgtgacggcg
acctcggcggcggccgcctga

DBGET integrated database retrieval system