KEGG   Bordetella genomosp. 13: CAL15_19065Help
Entry
CAL15_19065       CDS       T05441                                 

Gene name
ompR
Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bgm  Bordetella genomosp. 13
Pathway
bgm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CAL15_19065 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bgm02022]
    CAL15_19065 (ompR)
Two-component system [BR:bgm02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   CAL15_19065 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C AHJR-like OKR_DC_1_N FleQ
Motif
Other DBs
NCBI-ProteinID: ARP96288
UniProt: A0A1W6ZFU4
Position
4229372..4230073
Genome map
AA seq 233 aa AA seqDB search
MDQPHTKLLVVDDDPALRQLLADYLNRHGYDTLLAPDANDLAARITRYAPDLLVLDRMLP
GGDGADACRRLREQGEDLPVILLTARDEAVDRIIGLEAGADDYLGKPFDPRELLARIEAV
LRRKRGPSALTKDSPVSFGPFVFDPATRQLLRDGTAVKLTGGEINLLEALVRNAGKPLSR
ERLLSLARDDDGGERNDRAIDIAVLRLRRAIEEDPKQPRWIQTVWGIGYRFSP
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaccccacaccaagctgctggtcgtcgacgacgatcccgcgctgcggcaattg
ctggccgattacctgaatcggcacggctacgacaccctgctggcgcccgacgccaacgac
ctggccgcgcgaatcacccgctacgcgccggacctgctggtgctggaccgcatgctgccc
ggcggcgacggcgccgatgcctgccgccgcctgcgtgaacagggcgaagacctgcccgtc
atcctgcttaccgcgcgcgacgaggccgtcgaccgcatcatcggcctggaggccggcgcg
gacgactacctcggcaagccgttcgatcctcgcgaactgctggcccgcatcgaggcggtg
ctgcgacgcaagcgcggcccctcggcgcttaccaaagactcgcccgtctcgttcggcccg
ttcgtgttcgacccggccacgcgccagctgctgcgcgacggcaccgcggtcaagctgacg
ggcggcgagatcaatctgctcgaggccctggtgcgcaacgcgggcaagccgctgtcgcgc
gaacgcctgctgtcgctggcgcgcgacgacgacggcggcgagcgcaatgaccgggcgatc
gacatcgccgtcctgcggctgcgccgcgccatcgaagaagaccccaagcagccacgctgg
atccagaccgtctggggcatcggctaccggttctctccctga

DBGET integrated database retrieval system