KEGG   Bordetella genomosp. 13: CAL15_19810Help
Entry
CAL15_19810       CDS       T05441                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
bgm  Bordetella genomosp. 13
Pathway
bgm00053  Ascorbate and aldarate metabolism
bgm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    CAL15_19810
Enzymes [BR:bgm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     CAL15_19810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 RmlD_sub_bind adh_short Polysacc_synt_2 adh_short_C2 KR Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ARP96415
UniProt: A0A1W6ZGM6
Position
4410165..4410998
Genome map
AA seq 277 aa AA seqDB search
MSDTSTQPYNRLLLTGAAGGVGRAIRPRLSAYARHVRLSDLAGPLQTQVAALAAHEEAAP
CDISDRAAFEQVAAGCDAIVHLGGVSVERPFEEILEANIKGVFNLYEAARRHGIKRVVFA
SSNHVTGFYRQDEVIDAHAPRRPDGYYGVSKSFGEDMAQLYFDRYGIETASIRIGSLFPE
PADRRMMSTWISLDDFDDLLRRCLYTPDIGHIVVYGMSDNRKVWWDNRHAAKLGFTPRDS
SEIYRDKIEAQPAPPPDDPSMTLQGGKFAVTGPFDPQ
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacatccacccaaccgtacaaccggctgctgcttactggcgccgcaggcggc
gtgggacgtgccattcggccgcgcctgtcggcttacgcccgacacgtgcgactttctgac
ctggccggccccttgcaaacgcaagtcgccgccctggccgcgcacgaagaggcggcgccg
tgcgacatctccgaccgcgcggcattcgagcaagtggccgcgggatgcgatgccatcgtc
cacctcggcggcgtctcggtcgaacgccccttcgaggaaatcctcgaggccaacatcaag
ggagtcttcaacctgtacgaagccgcgcgtcgccatggcatcaagcgcgtggtgttcgcc
agctccaaccacgtcaccggcttctaccggcaggacgaggtcatcgacgcccacgcgccg
cgccgccctgacggctattacggcgtgtccaaatcgttcggggaagacatggcgcagctg
tacttcgaccgctacggcatcgaaacggccagcatccgcatcggctcgctgtttcccgaa
cctgccgaccgccgcatgatgtccacctggatcagcctcgacgacttcgacgacctgctg
cgccgctgcctgtacacgcccgacatcggccacatcgtggtctacggcatgtcggacaac
cgcaaggtgtggtgggacaaccgccatgccgccaagcttggcttcacgccgcgcgacagt
tccgaaatctatcgagacaagatcgaggcgcaaccggcgcccccgccggacgacccttcg
atgacgctgcaaggcggcaagtttgccgtcacggggccgttcgacccgcaataa

DBGET integrated database retrieval system