KEGG   Borrelia garinii NMJW1: BgCN_0644Help
Entry
BgCN_0644         CDS       T02299                                 

Definition
(GenBank) beta-glucosidase, putative
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bgn  Borrelia garinii NMJW1
Pathway
bgn00520  Amino sugar and nucleotide sugar metabolism
bgn01100  Metabolic pathways
bgn01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bgn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BgCN_0644
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    BgCN_0644
Enzymes [BR:bgn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BgCN_0644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 COesterase CPSase_L_D3
Motif
Other DBs
NCBI-GeneID: 13812836
NCBI-ProteinID: AFT83935
Position
complement(646212..647807)
Genome map
AA seq 531 aa AA seqDB search
MEREKLINEMVNKMQDHELLGQMFMISYPNQSITNFVLDFISKKNLGGIKIFGWNAKNLK
NLIESINKAQKTSQNNKFKIPLFVATDQEGGLAQHIKLNTSETIGNLGIAASLSPKDSYN
TGYYIAQELSQLGINLNFAPIVDIYSDENNFTIGPRTYSDNPKIVSLFSLAFYKGQKQGG
IISTAKHFPGHGNTTLDSHINIPIINSNLLEINLNELLPYKILIQENIPVIMTGHIAYPK
LTNGENIPASSSTKIIKDILRKKLKYNNIIITDDLLMNAVKYNNESIYNTIERIVRTKSD
IFLISLNENIQKNAYNMLLGLMKKDSEIKNNIIESNKRILRIKLEYLKENKNQSDLYPNF
NKNEKIYSKEGEKFFEQSTLRGITKVRIEKEISKTKKTLIISPYYKMIAEGKKIFQNTYA
YYYNYYPLNGINPQKLDEIKKLIKKFDQVIFNLSTPGSLKYLENLKEYKDKISVIVSLTP
QHIKKLNWIKNIVIIYGTTPLTFKSGLLTLTKDFDPKGTIPLRDITNKYYP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagaaaaactaataaacgaaatggtaaacaaaatgcaagaccatgagctatta
ggacaaatgtttatgataagctatccaaatcagtcaataacaaattttgttcttgatttt
ataagtaaaaaaaaccttggtggaattaaaatttttggatggaacgcaaaaaatttaaaa
aacttaatagaaagtattaataaagctcaaaaaacatctcaaaataataaatttaaaatt
cctttatttgtagcaacagatcaagaaggggggttggcacagcacataaaattaaataca
tcagaaacaattggtaatcttgggattgcagcatctctatctccaaaagattcttacaac
acaggatattatatagcacaagagctaagtcagcttggaataaatttaaattttgcaccc
atagtagatatatatagtgacgaaaataatttcacaataggaccaagaacatattcagat
aaccctaaaatagtatcacttttttctctggccttttacaaaggacaaaagcaaggggga
ataatttctactgcaaagcatttcccaggacacggcaatactactcttgactcccatata
aatattccaataataaattctaatttactagaaataaatttaaatgaacttttgccatat
aaaatattaatccaagaaaacattcctgtaataatgacaggccatatagcatatccaaag
cttacaaatggagaaaatattcctgcatcatcctcaacaaaaataattaaagatatacta
agaaaaaaattaaaatataataacataataattactgatgacctattaatgaatgcagta
aaatacaataatgagagtatttataatacaatcgaaagaatagttagaaccaaaagtgac
atttttttaatatctttaaatgaaaatatacaaaaaaatgcttacaacatgttactaggc
ttaatgaaaaaagattcagaaataaaaaacaatattattgaatctaataaaagaatatta
agaataaaattggaatacttaaaagaaaataaaaatcaatctgatctttatcctaatttc
aataaaaatgagaaaatatattcaaaagaaggtgaaaaatttttcgaacaaagcacatta
agaggtattacaaaagtaagaatagaaaaagaaatatctaaaactaaaaaaacccttata
atatctccttattacaaaatgattgcagaaggcaaaaaaatatttcaaaatacatatgct
tattattataactattatccgttaaatgggattaatccccaaaaactcgacgaaattaaa
aaattaattaaaaaatttgatcaagtaatctttaatttatcaacacccggaagcttaaaa
tacttagaaaatttgaaagaatataaagataaaataagtgtaattgtatctcttacgcct
caacatattaaaaaattaaattggataaaaaacatagtaatcatttatggaacaacacct
ctgacatttaaatctggacttttaacactcactaaggattttgatccaaaaggaactatc
cctttaagggatattacaaataaatattatccttaa

DBGET integrated database retrieval system