KEGG   Burkholderia gladioli ATCC 10248: BM43_1459Help
Entry
BM43_1459         CDS       T03826                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00360  Phenylalanine metabolism
bgo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bgo00790  Folate biosynthesis
bgo01100  Metabolic pathways
bgo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BM43_1459 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BM43_1459 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BM43_1459 (phhA)
Enzymes [BR:bgo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BM43_1459 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AJW98396
UniProt: A0A095FHD9
Position
1:complement(1577066..1577965)
Genome map
AA seq 299 aa AA seqDB search
MSTVVTAKLQEQFDAGLETRADFTIDQPLERYGRVDHAVWAQLYARQTALLEGRAADAFV
AGMKRLTLPADRVPSFEEVNRQLEPATGWKIVAVPGLVPGDVFFAHLAERRFPVTWWMRR
PDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMHAYGRAALAVADDPFALSLLGRLYWYTV
EFGLIRSRHDRDTLQIYGAGIVSSRGESVYSLESEAPNRIGFELDRVMRTAYRIDTFQKT
YFVIDDFEQLFALLKVDARALARRLAGMSEYPAGAVLDGDRVIHRGTGEGWAQDQDATH
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcgtcaccgcgaaactgcaggagcagttcgacgcgggcctcgaaacccgc
gccgatttcaccatcgaccagccgctcgagcgttacggccgggtcgatcacgcggtgtgg
gcgcagctctatgcgcggcagacggcgctgctggaagggcgcgccgccgatgccttcgtg
gcaggcatgaagcggctcacgctgccggccgatcgcgtgccctcgttcgaggaggtgaac
cggcagctcgagcccgccaccggctggaagatcgtcgcggtgccgggcctggtgcccggc
gacgtgttcttcgcccacctggccgaacggcgcttcccggtgacctggtggatgcgccgc
ccggaccagctcgactacctgcaggaacccgactgcttccacgacctgttcggccacgtg
ccgctgctgatcgacccggtgttcgccgactacatgcacgcctacggccgggccgcgctg
gcggttgccgacgatcccttcgcgctctcgctgctgggtcggctctactggtacacggtc
gagttcgggctgatccgcagccggcacgatcgcgacacgctgcagatctacggcgcgggc
atcgtgtcgagccgcggcgagtcggtctacagcctggagagcgaggcgcccaaccggatc
ggcttcgagctcgaccgggtgatgcgcaccgcctatcgcatcgacaccttccagaagacc
tatttcgtgatcgacgacttcgagcaattgtttgccctgctgaaggtcgacgcgagggcg
ctggccaggcgcctggccggcatgagcgagtatccggccggcgcggtgctcgacggggat
cgggtgatccatcgcggcaccggcgagggctgggcgcaggaccaggacgccacgcactga

DBGET integrated database retrieval system