KEGG   Burkholderia gladioli ATCC 10248: BM43_2754Help
Entry
BM43_2754         CDS       T03826                                 

Definition
(GenBank) mandelate racemase/muconate lactonizing enzyme
  KO
K20023  L-talarate/galactarate dehydratase [EC:4.2.1.156 4.2.1.42]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00053  Ascorbate and aldarate metabolism
bgo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BM43_2754
Enzymes [BR:bgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.42  galactarate dehydratase
     BM43_2754
    4.2.1.156  L-talarate dehydratase
     BM43_2754
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AJX00421
UniProt: A0A095H7Q5
Position
1:complement(3001647..3002807)
Genome map
AA seq 386 aa AA seqDB search
MNTVKPLTPQASNDRIKWIRIASTFLPLANPISDAKVLTGRQKPMTEIAILFVEIETADG
HRGLGFSYSKRAGGPGQFAHAKEIAPVLLEEDPNDIARLWDKLAWAGASVGRSGMAAQAI
GAFDVALWDLKAKRANLSLAKLLGAQRDSVRCYNTSGGFLHTPLDQLLVNTEISREKGIG
GIKLKVGQPDCTLDIHRVSTVRKQLGDTFPLMVDANQQWDRPTAQRMCRTFEQFDLIWIE
EPLDCYDAEGHAALAAQFDTPIATGEMLTSVSEHWEFIRQRGADYLMPDAPRVGGVTPFL
KVATLAEHAGMMLAPHFAMELHVHLAAAYSREPWVEHFEWLEPLFNEKLETRDGRMIVPT
RPGLGLTLSERVAGWTAQEAEFGQRG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgtcaagccgctcacgccgcaagcatcgaacgaccgcatcaagtggattcgg
atcgcctcgacgttcctgccgctcgccaatccgatcagcgacgcgaaggtgctgaccggc
cgccagaagccgatgaccgaaatcgcgatcctgttcgtcgagatcgagacggccgacggc
caccgcggcctcggtttcagctattcgaagcgtgccggcgggccgggccagttcgcacat
gcgaaggaaatcgcgccggtgctgctcgaagaagatccgaacgacatcgcgcggctgtgg
gacaagctcgcctgggccggcgcatcagtgggccgcagcgggatggcggcgcaggcgatc
ggcgcgttcgatgtggcgctgtgggatctgaaggcgaagcgcgcgaacctgtcgctggcc
aagctgctcggcgcgcagcgcgattcggtgcgctgctacaacacctcgggcggcttcctg
catacgccgctcgatcaactgcttgtgaacaccgaaatctcgcgcgagaagggcatcggc
ggtatcaagctgaaggtcggccagcccgactgcacgctcgacatccatcgcgtctcgacc
gtgcgcaagcagttgggcgacacgttcccactgatggtcgacgcaaaccagcaatgggac
cgcccgaccgcgcaacgcatgtgccgcacgttcgaacaatttgacctgatctggatcgag
gagccgctcgactgctacgacgccgaaggccacgccgcgctcgccgcgcagttcgacacg
ccgatcgccactggcgagatgctgacgagcgtgtccgagcactgggaattcatccgccag
cgcggcgccgattacctgatgcccgacgcgccgcgcgtgggcggcgtcacgccgttcctg
aaggtggccacgctggccgagcacgccggcatgatgctcgcgccgcacttcgcgatggaa
ctgcatgtgcatctggcggcggcgtactcgcgcgagccgtgggtcgaacacttcgaatgg
ctcgaaccgctgttcaacgagaagctcgagacgcgcgacgggcggatgatcgtgccgacg
cggccggggctcgggttgacgttgagcgagcgggtggcgggatggacggcgcaggaagcg
gagtttgggcagcggggataa

DBGET integrated database retrieval system