KEGG   Burkholderia gladioli ATCC 10248: BM43_2883Help
Entry
BM43_2883         CDS       T03826                                 

Definition
(GenBank) aminotransferase class I and II family protein
  KO
K16423  (S)-3,5-dihydroxyphenylglycine transaminase [EC:2.6.1.103]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00261  Monobactam biosynthesis
bgo01055  Biosynthesis of vancomycin group antibiotics
bgo01100  Metabolic pathways
bgo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    BM43_2883
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    BM43_2883
Enzymes [BR:bgo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.103  (S)-3,5-dihydroxyphenylglycine transaminase
     BM43_2883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: AJW98140
UniProt: A0A095EWF6
Position
1:3169523..3170815
Genome map
AA seq 430 aa AA seqDB search
MGERALSTQASAGASRLSVMNFLNEAANEYPQAISFASGRPAEQFFSLEGWLEAVPDYQA
HAARAAGQDLALAGRRLAQYGRTAGIINALIAEQLRLDEGVDCDASQVVVTAGCQEALAL
LVPALCRASGDVMLARNPTYIGITGVADFAGIEILPVECEAGENWEQALARTAAALRRAG
KTARGFYLTPEFDNPTGTVLDEAERRSIIAGCLEHRIVVLEDNPYGMFRYDGESTRPMMA
LDPAGCVIYLATYSKTLCPAVRVGAAVLPRRLFGSEQAAERLRAEVSERKSFVTVNTSQV
TQALVGGVLLREGHSLRRLVDAPRRFYHDNRDALLGALERAFGTDGEIRWNRPDGGFFLG
VTLPFEFGERETVECARDHGVIVMPMTFFSLDASRRREVRLAFSNAGAAEIEAGVARFAS
YLGEKRASLA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgggagagagggccttgtcgactcaagcaagcgccggagcctcgcggctctcggtgatg
aatttcctcaacgaggccgccaacgagtatccgcaggcgatctccttcgcctcgggccgc
ccggccgagcagttcttctcgctggaaggctggctggaggcggtgcccgactaccaggcc
cacgcggcccgcgcggccggccaggacctcgcgctggcgggccggcggctcgcccagtac
ggccgtacggccggcatcatcaatgccctgatcgccgagcaactgcgcctggacgaaggc
gtcgactgcgatgcctcgcaggtggtggtgacggccggctgccaggaggcgctggcgctg
ctggtgcccgcgctgtgccgcgccagcggcgatgtgatgctggcgcgcaatcccacctat
atcggcatcaccggcgtggccgatttcgccggcatcgagatcctgcccgtcgaatgcgag
gccggcgagaactgggagcaggcgctggcccgcaccgccgccgcgctgcgccgcgccggc
aagaccgcgcgcggcttctacctgacgcccgagttcgacaatccgaccggcaccgtgctc
gacgaggccgagcggcgctcgatcatcgccggctgcctggagcatcgcatcgtggtgctc
gaggacaatccctacggcatgttccgctacgacggcgagtcgacccggccgatgatggcg
ctcgatccggccggctgcgtgatctacctggccacctattcgaagacgctgtgcccggcc
gtgcgggtcggcgcggcggtgttgcccaggcgcctgttcggcagcgagcaggccgccgag
cgcctgcgcgcggaagtctcggagcgcaagagcttcgtgaccgtcaacaccagccaggtg
acccaggccctggtgggtggcgtgctgctgcgcgagggccatagcctgcggcgactggtc
gatgcgccgcgccgcttctaccacgacaatcgcgacgcgctgctgggcgcactcgaacgc
gccttcggcaccgatggcgagatccgctggaatcgccccgacggcggcttcttcctcggc
gtcacgctgcccttcgagttcggcgagcgcgagaccgtggaatgcgcgcgcgatcacggc
gtgatcgtgatgccgatgaccttcttctcgctcgacgcctcgcgacgccgcgaagtgcgg
ctcgccttcagcaatgccggcgcggccgagatcgaggccggcgtggcgcgcttcgccagc
tacctcggcgagaagcgcgcctcgctcgcctga

DBGET integrated database retrieval system