KEGG   Burkholderia gladioli ATCC 10248: BM43_3660Help
Entry
BM43_3660         CDS       T03826                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bgo  Burkholderia gladioli ATCC 10248
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BM43_3660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJX01067
UniProt: A0A095VX32
Position
1:complement(4093283..4094293)
Genome map
AA seq 336 aa AA seqDB search
MHSIQLAIWAVATLVLVALVFDFMNGFHDAANSIATVVSTGVLKPQQAVAFAAMFNVIAY
FVFHLKVAQTVGKGTIDPSIVDHYVVFGALVGAIGWNIITWYYGIPSSSSHALIGGLVGA
AVAKSGWGSLNLDGLMKTVAFIFISPLLGFVLGSLFMLGVSWLYFRTPPSKVDRRFRRLQ
LVSAGLYSLGHGGNDAQKTIGMIWMLLIATGYASTTADAPPIWVIAACYLSMGLGTLFGG
WRIVRTMGQKITKLKPVGGFCAELGGALTLFSASWMGIPVSTTHTITGAIVGVGATRKLS
AVRWGVAGNIIWAWVLTIPASALIAAAGWWVGHRVF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcattcgatacaactcgccatctgggccgtcgcgacgctggtactggtcgcgctcgtg
ttcgacttcatgaacggtttccacgacgcggcgaactcgatcgccaccgtcgtgtcgacc
ggcgtgctcaagccgcaacaggccgtcgccttcgccgcgatgttcaacgtcatcgcctat
ttcgtgttccacctgaaggtcgcgcagacggtcggcaagggcaccatcgatccctccatc
gtcgatcactacgtggtgttcggcgcgctggtgggcgccatcggctggaacatcatcacc
tggtactacggcatcccctcgagctcctcgcatgcgctgatcggcggcctggtgggcgcg
gcggtggccaagtcgggctggggctccctgaacctcgacgggctgatgaagacggtcgcc
ttcatcttcatctcgccgctgctcggcttcgtgctcggctcgttgttcatgctcggcgtg
tcatggctgtatttccgtacgccgcccagcaaggtcgaccggcgcttccggcgcctgcaa
ctggtgtcggccgggctctacagcctgggtcacggcggcaacgacgcgcagaagaccatc
ggcatgatctggatgctgctgattgccaccggctatgcctcgaccacggccgatgcgccg
ccgatctgggtgatcgcggcctgctacctgtcgatgggcctgggcacgctgttcggcggc
tggcggatcgtgcgcacgatggggcagaagatcaccaagctcaagccggtcggtggtttc
tgcgccgagctgggtggcgcgctgacgctgttctcggcgtcctggatggggatcccggtc
tccaccacgcataccatcaccggcgcgatcgtcggggtgggtgccacccgcaagctctcg
gccgtgcgctggggcgtggccggcaatatcatctgggcctgggtgctgacgattccggcc
tcggcgctgatcgccgcggccggctggtgggtcgggcaccgcgtgttctga

DBGET integrated database retrieval system