KEGG   Burkholderia gladioli ATCC 10248: BM43_3734Help
Entry
BM43_3734         CDS       T03826                                 

Gene name
ompR
Definition
(GenBank) transcriptional regulatory protein ompR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BM43_3734 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bgo02022]
    BM43_3734 (ompR)
Two-component system [BR:bgo02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BM43_3734 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF43
Motif
Other DBs
NCBI-ProteinID: AJX00375
UniProt: A0A095G226
Position
1:4176764..4177489
Genome map
AA seq 241 aa AA seqDB search
METKNPSKILVVDDDPRLRDLLRRYLGEQGFNVYVAENATAMNKLWVRERFDLLVLDLML
PGEDGLSICRRLRGSNDRTPIIMLTAKGEDVDRIVGLEMGADDYLPKPFNPRELVARIHA
VLRRQAPAELPGAPSETTEVFEFGEFSLNLATRTLTKSGQEIPLTTGEFSVLKVFARHPR
QPLSREKLMELARGREYEVFDRSLDVQISRLRKLIEPDPGSPRFIQTVWGLGYVFIPDGA
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaaaatccctcgaaaatcctcgtcgtcgacgacgatccccgtttgcgcgac
ctgctgcgccgctacctcggcgagcagggcttcaacgtatatgtcgccgaaaatgcgacg
gcaatgaacaagctctgggtgcgcgagcgtttcgacctgctggtgctcgacctgatgctg
cccggcgaggacggcctgtcgatctgccgccgcctgcgcggcagcaacgaccgcacgccg
atcatcatgctcacagccaagggcgaggacgtggaccgcatcgtcggcctcgagatgggc
gccgacgactacctgcccaagcccttcaatccgcgcgagctggtcgcgcgcatccacgcg
gtgctgcgccgccaggcgccggccgaactgccgggcgcgccctcggaaaccaccgaggtg
ttcgagttcggcgagttctcgctgaacctggctacccgcacgctgaccaagtccggccag
gagattccgctgaccaccggcgaattctcggtgctcaaggtcttcgcgcgtcatccgcgc
cagccgctgtcgcgcgagaagctgatggaactcgcacgcggccgcgaatacgaagtgttc
gaccgcagcctcgacgtgcagatctcgcgcctgcgcaagctgatcgagcccgatccgggc
agcccgcgcttcatccagaccgtctggggcctcggctacgtattcatccccgacggcgcc
gcctga

DBGET integrated database retrieval system