KEGG   Burkholderia gladioli ATCC 10248: BM43_3782Help
Entry
BM43_3782         CDS       T03826                                 

Definition
(GenBank) amidohydrolase family protein
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00520  Amino sugar and nucleotide sugar metabolism
bgo01100  Metabolic pathways
bgo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BM43_3782
Enzymes [BR:bgo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     BM43_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AJW97768
UniProt: A0A095HBA7
Position
1:4224811..4226010
Genome map
AA seq 399 aa AA seqDB search
MNNILTASGWAFGLLETGADGRIAAIRARPVGTPLPGYGYLLPGFVDLHVHGAGGVDLMD
GGEAAQQVAASLAASGTTAFLATTMTAPEAELREATAAIGRVERRERPAHCARLLGVHLE
GPFLNPGQLGAQPPHARRARDGEIDTLLALASVRLVTLAPELEGQLDTIRRLVRRGIRVQ
LGHSSGSYEQGVAALQCGASGFAHLFNAMSGLHHRAPGLVGAALAHAEYAEMIPDLAHLH
AGAMRAALRAIPRLYCVSDACAATGMPDGAYRLGAQRVFRRPGQAGARLADGRLAASTLT
LDAALRNLVKLGLSIADASNRVSRFPADFLGLPERGRLAPGAWADTVRLDPELRVEAVTI
EGRTVERAAPSRRQPPESRPESWSESRPDPRPCTEAGHV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatatcctcaccgcctccggctgggccttcggcctgctcgaaaccggcgccgac
ggccggatcgccgcgatccgcgccaggccggtcggcacgcccctgcccggctacggctac
ctgctgccgggtttcgtcgacctgcacgtgcacggcgcgggcggggtcgacctgatggac
ggcggcgaggccgcgcaacaggtggccgcctcgctcgcggccagcggcaccacggccttc
ctggcgaccaccatgacggcgccggaagccgaactgcgcgaagccaccgccgcgatcggc
cgcgtcgagcgccgcgagcggccggcgcattgcgcgcgcctgctcggcgtccatctcgaa
ggcccgttcctcaaccccgggcagctcggcgcgcagccgccgcatgcgcgccgggcacgg
gacggcgagatcgacacgctgctcgcgctcgccagcgtgcgcctggtgacgctcgcgccc
gaactggaggggcagctcgacacgatccgccggctggtccggcgcggcatccgcgtccag
ctcggccattcgagcggcagctacgagcagggcgtggccgcgctgcaatgcggcgcgagc
ggcttcgcccacctgttcaatgccatgagcgggctgcatcatcgcgccccgggcctggtt
ggcgcggcgcttgctcatgccgaatacgccgagatgatccccgacctcgcccatcttcac
gccggcgcgatgcgcgcggcgctgcgcgcgatccccaggctctattgcgtgagcgacgcc
tgcgcggccaccggcatgcccgacggtgcctaccggctgggcgcgcagcgcgtgttccgg
cgcccgggccaggccggcgcacggctcgccgacggccggctggccgccagcacgctgacc
ctggatgcggcgctgcgcaacctggtgaagctcgggctgtcgatcgccgacgcctcgaac
cgcgtctcgcgctttccggccgacttcctcggcctgcccgagcgcggccggctcgcgccc
ggcgcctgggccgacacggtgcgcctcgatccggaactgcgcgtggaggccgtcaccatc
gagggacgcacggtggagcgcgcggccccctcgcgccgacagccgcccgaaagccggccg
gaaagctggtcagaaagccggcccgacccgcggccctgcaccgaagccgggcatgtttag

DBGET integrated database retrieval system