KEGG   Burkholderia gladioli ATCC 10248: BM43_6047Help
Entry
BM43_6047         CDS       T03826                                 

Definition
(GenBank) phospholipase C, phosphocholine-specific
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00562  Inositol phosphate metabolism
bgo00564  Glycerophospholipid metabolism
bgo01100  Metabolic pathways
bgo01110  Biosynthesis of secondary metabolites
bgo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BM43_6047
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BM43_6047
   00565 Ether lipid metabolism
    BM43_6047
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    BM43_6047
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bgo02042]
    BM43_6047
Enzymes [BR:bgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     BM43_6047
Bacterial toxins [BR:bgo02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   BM43_6047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase DUF756 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AJW96888
UniProt: A0A095F9F7
Position
2:2406965..2409235
Genome map
AA seq 756 aa AA seqDB search
MTFDSSKRRFLKTTLGSAAAAATLSSFPPAIRRALAIDANNATGTLKDVKHVVLLMLENR
SFDSYFGTFRGVRGYGDRFAVPSAAGAANIFHQRYTKAGETSTLTPYHLDETQGNALRAG
STPHTWNDAQAAWDHGRMSAWPSAKTPLSLGYYEAAEVPFHRALADAFTICDAYHCGMHT
GTIANRLFYWSGTNGPNGLSPADNNPVRVAALNNEFNGGNDIGPSTSGWTWTTYADRLQQ
AGVSWKVYQSLVDNFGCNEMMSFRHWRAAIEQMPEARRPVYVSTVDIRQAVTAAGPFYDP
SIDDALSPLAKGFGNTMPEGFLETFRDDIQNGTLPAVSWIIPPSYYSEHPGPSSPAQGGW
YVQEVLDALTANPEVWSQTVLLVNYDENDGFFDHLPPPSAPSRNPDGSLAGGSTLPADQM
APEYHDFTPATANQPAIDGRPYGPGPRVPMWVISPWSRGGFVNSQVFDHTSTLLFLEKRF
GVVEPQISAYRRAICGDLTSCFNFVSPNEGALPMLSGRTSKVSADSLAASQGAAKAIPVP
SATLTSALPAQATGARASRALPYELHTTAHPAAGAITLEFANASANAAGAVFHVYDRLHL
DRIPRRYVVEAGKTLSGSWTPDAADQGSYDLWVLGPNGYHREYVGKLGDIAAGADPEVQV
CYQPCDASALSVKLFNRGSRPARFTVTANAYRGDGPWTLELAANASGELSWSVAEHGNWY
DFTVASSNAPSFSRRFAGRIETGKDSVSDPAMGMAG
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcgactcttccaaacgccggttcctgaagaccacgctcggcagcgcggccgcc
gcggccacgctctccagctttccgcccgcgatccggcgcgcgctcgcgatcgacgccaac
aacgccaccggcacgctcaaggacgtcaagcacgtggtgctgctgatgctcgagaaccgc
tcgttcgacagctacttcggcaccttccgcggcgtgcgcggatatggcgaccgcttcgcg
gtgccgtcggcggcgggcgcggccaacatcttccaccagcgctacaccaaggccggcgag
accagcacgctcacgccctaccatctcgacgagacgcagggcaacgcgctgcgcgccggc
agcacgccgcacacctggaacgacgcgcaggccgcctgggatcacggccgcatgtcggcc
tggccgagcgcgaagacgccgctctcgctcggctactacgaagccgccgaggtacccttc
catcgcgcgctggccgatgccttcacgatctgcgatgcgtatcactgcggcatgcacacc
ggcaccatcgccaaccgcctgttctactggagcggcaccaacggcccgaacggcctgagc
ccggccgataacaacccggtgcgcgtggccgcgctcaacaacgagttcaacggcggcaac
gacatcggcccgtccacctcgggctggacctggaccacctatgccgaccggttgcagcag
gcgggcgtgagctggaaggtctaccagagcctggtcgacaatttcggctgcaacgagatg
atgagcttccgccactggcgcgccgcgatcgagcagatgccggaggcgcgccgcccggtg
tacgtgtcgacggtggacatcaggcaggcggtgaccgccgccggcccgttctacgatccg
agcatcgacgacgcgctgagcccgctcgccaagggtttcggcaacaccatgccggaaggc
ttcctggagaccttccgcgacgatatccagaacggcacgctgccggcggtgtcgtggatc
atcccgccctcgtactacagcgagcatccggggccgtcgagcccggcgcagggcggctgg
tacgtgcaggaagtgctcgacgcgctgaccgccaaccccgaggtctggagccagaccgtg
ctgctggtgaactacgacgagaacgatggcttcttcgaccacctgccgccaccgagcgcg
ccctcgcgcaatcccgacggctcgctggccggcggcagcaccttgccggccgaccagatg
gcgcccgagtatcacgacttcacgccggccaccgcgaaccagcccgccatcgacggccgc
ccttacggcccgggcccgcgcgtgccgatgtgggtgatctcgccgtggagccgcggcggt
ttcgtcaattcgcaagtgttcgatcacacctccaccctgctgtttctcgagaagcgtttc
ggcgtggtcgagccgcagatcagcgcttatcgccgggcgatctgcggcgacctcacctcc
tgtttcaacttcgtctcgcccaacgagggcgcgctgcccatgctgtcgggccgcaccagc
aaggtgagcgccgattcgctggcggcctcgcaaggtgccgcgaaggcgatcccggtgccg
agcgcgacgctcacctcggcgctgcccgcgcaggccaccggcgcgcgcgcctctcgcgcg
ctgccctatgaactgcacaccaccgcgcatccggccgccggggcgatcacgctggaattc
gcgaacgccagcgccaatgcggcgggcgccgtgttccatgtctacgatcgcctgcacctg
gaccggatcccgcgccgttatgtggtggaggccggcaagacgctgagcggcagctggaca
cccgatgccgccgaccagggcagctacgacctctgggtgctcgggccgaacggctatcac
cgcgaatacgtcggcaagctgggcgacatcgcggctggcgccgatcccgaggtgcaggtc
tgctaccagccctgcgatgcctcggcgcttagcgtgaagctgttcaatcgcggcagccgg
ccggcccggttcacggtaacggcgaacgcctatcgcggcgacggcccgtggacgctcgaa
cttgccgcgaacgcctcgggcgagttgagctggagcgtcgccgagcacggcaactggtat
gacttcacggtcgccagcagcaatgcgccgagtttctcgcggcgcttcgcgggacgcatc
gagaccggcaaggattcggtgtccgatccggcgatggggatggcgggctga

DBGET integrated database retrieval system