KEGG   Burkholderia gladioli ATCC 10248: BM43_7072Help
Entry
BM43_7072         CDS       T03826                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bgo  Burkholderia gladioli ATCC 10248
Pathway
bgo00360  Phenylalanine metabolism
bgo00362  Benzoate degradation
bgo00621  Dioxin degradation
bgo00622  Xylene degradation
bgo01100  Metabolic pathways
bgo01120  Microbial metabolism in diverse environments
bgo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BM43_7072 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BM43_7072 (dmpG)
   00622 Xylene degradation
    BM43_7072 (dmpG)
   00621 Dioxin degradation
    BM43_7072 (dmpG)
Enzymes [BR:bgo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     BM43_7072 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AJW96242
UniProt: A0A095F6U1
Position
2:3661383..3662516
Genome map
AA seq 377 aa AA seqDB search
MNLISDATLRDGNHAIRHQLGREQIADYARAANAAGIDIVEVGHGNGLGGSSCLLGQTPI
DDVLMLETARAALTTSWLGVHFIPGLGKATDIELAIEAGVDVVRVATHCTEANVSRRFIE
QTRRAGRVAYGVLMMSHMAPPEVLLAQARLMQDYGAQAVILMDSAGYSTPNLVREKVRLL
VEALRVDVGFHAHNNLGLAVANSLVALEQGARIVDACVKGFGAGAGNTQLETLVAAMERE
GHAANTSFERVTALASESEAFLSPKTPHIAAANIASGLYGLFSGYVPHIQKAALEFGVNE
FELYRRLAERRLVAGQEDIITEEASRLARSPEAGGASGAGGGAAAGEVAAATASGAAGAA
GAGPAARRRETAGELSA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgatcagcgacgccaccctgcgcgacggcaatcacgcgattcgccaccagctc
ggccgcgagcagatcgccgactacgcgcgcgcggccaacgcggccggcatcgacatcgtc
gaggtcggccacggcaacgggctgggcggctcgtcctgcctgctcggccagactccgatc
gacgatgtcctgatgctggagacggcgcgcgcggcgctcaccaccagctggctcggcgtg
catttcatcccggggctgggcaaggccaccgacatcgagttggcgatcgaggccggcgtg
gacgtggtgcgggtggccacccactgcaccgaggccaatgtctcgcggcgcttcatcgag
cagacgcggcgcgcggggcgggtggcctacggcgtgctgatgatgtcgcacatggcgccg
cccgaggtgctgctggcccaggcgcggctgatgcaggactacggcgcgcaggcggtgatc
ctgatggacagcgccggttattcgacgccgaacctggtgcgcgagaaggtgcgcctgctg
gtagaggcgctacgcgtcgacgtgggtttccacgcgcacaacaacctcggcctggcggtg
gccaacagcctggtggcgctggagcagggcgcgcgcatcgtcgacgcctgcgtgaagggc
ttcggcgccggcgccggcaatacccagttggagacgctggtggccgcgatggagcgcgag
gggcatgccgcgaacaccagcttcgagcgcgtgacggcgctggcgagcgagagcgaggcc
ttcctgagcccgaagacgccgcatatcgccgccgccaacatcgccagcggcttgtacggg
ctgttctccggctacgtgccgcatatccagaaggccgcgctcgaattcggcgtgaacgag
ttcgagctgtaccggcggctggccgagcggcggctggtggcggggcaggaggacatcatc
accgaggaggcgagccggctggcgcgctcgccggaggcaggcggggcgagtggggcgggt
ggtggggcggcggccggcgaggtggcagcagcgacagcgagcggggccgccggcgcagcc
ggcgccggtccggccgcccggcgccgcgagacggccggcgagctgtcggcctga

DBGET integrated database retrieval system