KEGG   Burkholderia plantarii PG1: BGL_1c00500Help
Entry
BGL_1c00500       CDS       T03632                                 

Gene name
phhA
Definition
(GenBank) phenylalanine-4-hydoxylase PhhA
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00360  Phenylalanine metabolism
bgp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bgp00790  Folate biosynthesis
bgp01100  Metabolic pathways
bgp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    BGL_1c00500 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BGL_1c00500 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BGL_1c00500 (phhA)
Enzymes [BR:bgp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     BGL_1c00500 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AJK44604
UniProt: A0A0B6RQY0
Position
1:complement(55506..56444)
Genome map
AA seq 312 aa AA seqDB search
MHRHRSHSEPAMSTVVTAMLQEQFDAGLETRPDFTIDQPLERYTRVDHAVWSQLYARQTA
LLEGRAADAFVAGMKRLTLPADRVPSFEDVNRQLRPATGWEIVAVPGLVPGDVFFAHLAN
RRFPVTWWMRRPDQLDYLQEPDCFHDLFGHVPLLIDPVFADYMHAYGQAALAVSDDPFAL
SLLGRLYWYTVEFGLIRSRHDPDQLRIYGAGIVSSRGESVYSLESDAPNRIGFDLDRVMR
TAYRIDTFQKTYFVIDDFEQLFALAKVDARALARRLAGLAEHPAGAVLAGDRVLHRGTGE
GWASDDDTTGRS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgtcaccgcagccattcagagccagccatgtccaccgtcgtcaccgcgatgctg
caggagcagttcgacgcgggtctcgagacccgcccggatttcaccatcgatcagccgctc
gagcgctatacgcgcgtcgatcacgcggtctggtcgcagctctatgcgcggcagacggcg
ctgctcgagggccgcgcggccgacgcgttcgtggccggcatgaagcgcctcacgctgccg
gccgaccgcgtgccgtcgttcgaggacgtgaaccggcagctcaggccggccaccggctgg
gagatcgtcgcggtgccggggctcgtgcccggcgacgtattcttcgcacaccttgcgaat
cgccgcttccctgtcacctggtggatgcgccgcccggaccagctcgactacctgcaggag
ccggactgcttccacgacctgttcggccacgtgccgctgctgatcgatccggtgttcgcc
gactacatgcatgcctacggccaggccgcgctcgccgtgtccgacgatccgttcgcgctg
tcgctgttgggccggctctactggtacacggtggaattcggcctgatccgcagccggcac
gaccctgaccagctgcgcatctacggcgccggcatcgtgtcgagccgcggcgaatcggtc
tacagcctcgagagcgacgcaccgaaccggatcggcttcgatctcgaccgcgtgatgcgc
accgcctatcgcatcgacacgttccagaagacctatttcgtgatcgacgatttcgagcag
ctgttcgcgctcgcgaaggtggacgcgcgcgcgctggccagacggctcgccgggctcgcc
gagcatccggccggcgccgtgctggccggcgaccgggtcctgcatcgcggcaccggcgaa
ggctgggccagcgacgacgacaccaccggccgctcctga

DBGET integrated database retrieval system