KEGG   Burkholderia plantarii PG1: BGL_1c04260Help
Entry
BGL_1c04260       CDS       T03632                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
bgp  Burkholderia plantarii PG1
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BGL_1c04260 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: AJK44968
UniProt: A0A0B6RNM9
Position
1:479441..479815
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVSVKTAYLPEQSDPERRQYAFAYTLTIRNTGQVTAQLIARHWVITDSEQKVQE
VKGLGVVGHQPLLKPGEQFEYTSWAVIATPVGTMRGAYFCVAEDGERFDAPVAEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtacgaattcagcgtgtccgtgaaaacggcctatctgccggaacaatccgac
ccggaacgccgtcaatatgcattcgcctacacgctgacgattcgcaataccggtcaggtg
acggcgcagctgatcgcgcggcactgggtgatcaccgacagtgaacagaaggtgcaggaa
gtgaagggactcggcgtggtcggccatcagccgctcctgaagccgggcgagcaattcgaa
tacacgagctgggcggtgatcgcgacgccggtgggcaccatgcgcggcgcctacttctgc
gtggccgaggacggcgagcgcttcgacgcgccggtcgccgaattcgcgctgcacatgccg
cgcacgctgcactga

DBGET integrated database retrieval system