KEGG   Burkholderia plantarii PG1: BGL_1c04870Help
Entry
BGL_1c04870       CDS       T03632                                 

Definition
(GenBank) kinase, PfkB family
  KO
K00856  adenosine kinase [EC:2.7.1.20]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00230  Purine metabolism
bgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BGL_1c04870
Enzymes [BR:bgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.20  adenosine kinase
     BGL_1c04870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AJK45023
UniProt: A0A0B6RNS7
Position
1:complement(547886..548824)
Genome map
AA seq 312 aa AA seqDB search
MATLICGSIAYDNIMTFEGRFREHILPDQVHLINLSFLVPTMRREFGGCAGNIAYALRAL
GGDARVMGTIGAIDAQLYLDRFDALGLARDYVRVVPDTHSAQAMITTDLDNNQIAAFHPG
AMMQSHLNHAGEARDIQLAIVGPDGFQGMVQHVEELAKAGVPFVFDPGQGLPLFDRDTLR
RSIELATYLAVNDYEAKLVSDKTGWSEDEIASRVQALIITRGEHGATLRHRDGTEQIPVV
KAEQIVDPTGCGDAFRGGLLYGIEKGLDWATTGRLASLMGSIKIAHPGPQTYTLGRAEIL
SRFQSAFGYSIE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttggctacgctgatttgcggttcgatcgcctacgacaacatcatgaccttcgaagggcgc
tttcgggagcacatcctgcccgaccaggtccacctcatcaatctgagcttcctcgtgccg
accatgcgtcgcgagttcggcggctgcgcaggcaacatcgcctacgcgctgcgcgcgctc
ggcggtgacgcccgcgtgatgggcacgatcggcgcgatcgacgcgcagctctacctcgac
cgcttcgatgcgctcggccttgcgcgcgactacgtgcgggtggtgccggacacacactcg
gcgcaggcgatgatcacgaccgatctcgacaacaaccagattgccgcgttccatccgggc
gcgatgatgcagtcgcacctgaaccacgcgggcgaagcgcgcgacatccaacttgcgatc
gtcggtccggacggcttccagggcatggtccagcacgtcgaggaactcgcgaaggccggc
gtgccgttcgtgttcgatccgggccagggcctgccgctgttcgaccgcgatacgctgcgg
cgcagcattgaacttgccacctatctggcggtcaacgattacgaagccaagctggtgagc
gacaagacgggctggtcggaagacgagatcgcgagccgggtccaggccctgatcatcacg
cgcggcgagcacggcgccaccctccgccaccgcgacggcaccgagcagatcccggtcgtc
aaggccgaacagatcgtcgatccgaccggttgcggcgacgcgttccgcggcggcctgctg
tacggcatcgagaaggggctggactgggcaaccaccggccgcctcgcgagcctgatggga
tcgatcaagatcgcgcatccgggaccgcaaacctacacgctcggccgagccgaaatcctg
tcccgcttccagagcgcgttcggctacagtatcgaatga

DBGET integrated database retrieval system