KEGG   Burkholderia plantarii PG1: BGL_1c07560Help
Entry
BGL_1c07560       CDS       T03632                                 

Gene name
hemN1
Definition
(GenBank) oxygen-independent coproporphyrinogen IIIoxidase HemN
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00860  Porphyrin and chlorophyll metabolism
bgp01100  Metabolic pathways
bgp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BGL_1c07560 (hemN1)
Enzymes [BR:bgp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     BGL_1c07560 (hemN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AJK45291
UniProt: A0A0B6RZ73
Position
1:complement(861837..863228)
Genome map
AA seq 463 aa AA seqDB search
MTSCSPSSLFRPDLLAKYAVNGPRYTSYPTALQFDEAFDPGHYARAAADPGAAASELSLY
VHIPFCATACFYCGCNRIATNNRAHAAPYLERLKRELALQAGRFDPDRVITQLHWGGGTP
TFLSDAQTAELMAATRACFPIAPDDEAEISIEIDPRTAVPATLAHLRMQGFNRLSLGVQD
VDAEVQRSINRVQPIERTASLISAARLVGYRSVSVDLIYGLPKQSVATFARTLDTVIELA
PDRISVFGYAHLPTLFKMQRRIDDAQLPPPAERVALLGLAIEMLTQAGYVYIGMDHFARP
GDELVAAQRNGTLQRNFQGYSTRADTDLIGVGVSSIGKVGDVYAQNAKDLAGWSAALDAG
RLPIVRGVRLSVDDRLRRDVIMRLMCNLTLPFAELEAAYGIRFAERFAPELAALGEFERD
GLLTIERDRLTIHPAGRLFVRNIAMTFDAYLSNAGAGRCSRTV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcctgctccccatcctcattgttccggcctgatttgctcgcgaagtacgcggtc
aacggcccgcgctacacgtcgtacccgaccgcgctgcagttcgacgaggcgttcgatccc
ggccactacgcgcgcgcggcggccgaccccggcgcggcagccagcgagctgtcgctgtac
gtccacatcccgttctgcgcgacggcctgcttctattgcggctgcaaccggatcgcaacc
aacaaccgcgcgcacgcggcgccgtatctcgaacggctcaagcgcgagctggcgctgcag
gccgggcgcttcgacccggaccgcgtgatcacgcagctgcactggggcggcggcacgccg
accttcctgtccgacgcgcagacggccgaactgatggccgccacgcgcgcctgctttccg
atcgcgcccgacgacgaggccgagatctcgatcgagatcgacccgcgcacggccgtgccg
gccacgctcgcgcatctgcgcatgcagggcttcaaccgcctgagcctcggcgtgcaggac
gtcgatgccgaggtgcagcgctcgatcaaccgggtccagccgatcgagcgcaccgccagc
ctgatctcggcggcgcggctggtcggctatcgctcggtcagcgtcgacctgatctacggg
ctgccgaagcagagcgtggccaccttcgcgcgcacgctcgacaccgtgatcgaactcgcg
ccggaccggatttccgtgttcggctacgcgcacctgccgacgctgttcaagatgcagcgc
cgcatcgacgacgcgcagctgccgccgccggccgagcgcgtcgcgctgctcggcctcgcc
atcgagatgctgacgcaggccggctacgtctacatcggcatggatcatttcgcgcggccc
ggcgacgaactggtcgccgcgcagcgcaacggcacgctgcagcgcaacttccagggctac
agcacgcgcgccgacaccgacctgatcggcgtgggcgtgtcgtcgatcggcaaggtcggc
gacgtctacgcgcagaacgcgaaggacctggccggctggagcgcggcgctcgacgcgggc
cggctgccgatcgtgcgcggcgtgcggctgtcggtggacgaccggctgcgccgcgacgtg
atcatgcggctcatgtgcaacctgacgctgccgttcgccgaactcgaagccgcctacggg
atccgcttcgccgaacgcttcgcgcccgaactcgccgcgctcggtgaattcgagcgcgac
gggctgctcacgatcgaacgcgaccgcctgacgatccatccggccgggcgcctgttcgtg
cgcaacatcgcgatgacgttcgacgcctacctgtcgaacgccggtgccgggcgctgctcg
cgcaccgtctga

DBGET integrated database retrieval system