KEGG   Burkholderia plantarii PG1: BGL_1c08210Help
Entry
BGL_1c08210       CDS       T03632                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase Zwf
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00030  Pentose phosphate pathway
bgp00480  Glutathione metabolism
bgp01100  Metabolic pathways
bgp01110  Biosynthesis of secondary metabolites
bgp01120  Microbial metabolism in diverse environments
bgp01200  Carbon metabolism
Module
bgp_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bgp_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
bgp_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BGL_1c08210 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BGL_1c08210 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgp04147]
    BGL_1c08210 (zwf)
Enzymes [BR:bgp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BGL_1c08210 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BGL_1c08210 (zwf)
Exosome [BR:bgp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BGL_1c08210 (zwf)
  Exosomal proteins of colorectal cancer cells
   BGL_1c08210 (zwf)
  Exosomal proteins of bladder cancer cells
   BGL_1c08210 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AJK45355
UniProt: A0A0B6RWF9
Position
1:complement(932857..934365)
Genome map
AA seq 502 aa AA seqDB search
MPWRGAFPTGRRHMQTDSSFTFVLFGGTGDLSMRKILPALFEAHRANMLAEAGRIVAVAR
HESDRAAYHGWVEEHVKPHARKASGNALDEAAWRRFLERIDYVHLDLGRPEDYKVLRDAI
GTLPGTRVFYLATGPSLFEPICKALAGVGLSEGARIVLEKPLGYDLASSNEINDAVGEIF
AEDQIYRIDHYLGKEPVQNLLALRFGNALFEPLWRREWVESIQITIAEELGVEARGDFYD
NTGALRDMVQNHLLQLLSIVAMEPPHSMDSDSVRDEKLRVLRALKPIDPRDISKVAVRGQ
YHGGTIKGTQVPAYATEPGVKPDSTTETYVALKVEIENWRWAGVPFFLRTGKRLADRVAE
IVVNFRAVPHSALGASALRAGANRLVIRLQPNETIRLYCLAKQPGEGMNLASVHLDLAFD
QFFKEGQMEAYQRLLLDVINGRLALFVRRDEQEAAWRWVEPIQSEWQKSLKPPKPYASGT
WGPAAASAMLAQHGTCWLEEEN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccgtggcgcggggcatttccaaccgggcggagacacatgcaaaccgattccagcttc
accttcgttctgttcggcggcaccggcgacctgtcgatgcgcaagatcctgccggcgctg
ttcgaggcgcaccgcgccaacatgctcgccgaggcgggacgtatcgtcgccgtcgcgcgc
catgagtcggatcgcgccgcctatcacggctgggtcgaggagcacgtgaagccgcatgcg
cggaaagcgtccggcaacgcgctcgacgaagcggcctggcggcggttcctcgagcgcatc
gactacgtccatctcgatctcggccgcccggaagactacaaggtgctgcgcgacgcgatc
ggcacgctgcccggcacgcgcgtgttctacctggccaccggcccgtcgctgttcgagccg
atctgcaaggcgctggccggcgtgggcttgagcgaaggcgcgcgcatcgtgctcgagaag
ccgctcggctacgacctcgcctcgtcgaacgaaatcaacgacgcggtgggcgagatcttc
gccgaggaccagatctaccggatcgaccactatctcggcaaggagccggtacagaacctg
ctcgcgctgcgcttcggcaatgcgctgttcgagccgctgtggcgccgcgaatgggtggag
agcatccagatcacgatcgccgaggagctcggcgtggaagcgcgcggcgatttctacgac
aacaccggcgcgctgcgcgacatggtgcagaaccacctgctgcagttgctgtcgatcgtc
gcgatggagccgccgcattcgatggattcggattcggtgcgcgacgaaaagctgcgcgtg
ctgcgcgcgctcaagccgatcgacccgcgcgacatcagcaaggtggccgtgcgcggccag
taccacggcggcaccatcaagggcacccaggtgcccgcctacgccaccgagcccggcgtg
aagccggacagcaccaccgaaacctacgtcgcgctgaaggtcgagatcgagaactggcgc
tgggccggcgtgccgttcttcctgcgcaccggcaagcggctcgccgaccgcgtcgccgag
atcgtcgtcaacttccgcgccgtgccgcattcggcgctcggcgcctccgcgctgcgcgcc
ggcgcgaaccgcctggtgatccggctgcagccgaacgagacgatccgcctctactgcctc
gccaagcagcccggcgagggaatgaacctcgcaagcgtgcatctcgacctcgcgttcgac
cagttcttcaaggaaggccagatggaggcctaccagcgcctgctgctcgacgtcatcaac
gggcgcctcgcgctgttcgtgcgccgcgacgagcaggaagccgcctggcgctgggtcgag
ccgatccagagcgaatggcagaaatcgctgaagccgccgaagccctacgcatcaggcacc
tgggggccggccgccgcgagcgcgatgctcgcgcagcacggcacctgctggctggaagaa
gagaattga

DBGET integrated database retrieval system