KEGG   Burkholderia plantarii PG1: BGL_1c19750Help
Entry
BGL_1c19750       CDS       T03632                                 

Gene name
metG1
Definition
(GenBank) methionyl-tRNA synthase MetG
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00450  Selenocompound metabolism
bgp00970  Aminoacyl-tRNA biosynthesis
bgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BGL_1c19750 (metG1)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BGL_1c19750 (metG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgp01007]
    BGL_1c19750 (metG1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bgp03016]
    BGL_1c19750 (metG1)
Enzymes [BR:bgp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BGL_1c19750 (metG1)
Amino acid related enzymes [BR:bgp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BGL_1c19750 (metG1)
Transfer RNA biogenesis [BR:bgp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BGL_1c19750 (metG1)
 Prokaryotic type
   Other AARSs
    BGL_1c19750 (metG1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 Glyco_transf_4 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AJK46484
UniProt: A0A0B6RWE8
Position
1:2265277..2266815
Genome map
AA seq 512 aa AA seqDB search
MTHRYITTPIYYVNDRPHLGHAYASVHADIMARYLRAAGHEVLLLTGADEHGEKIAKAAM
LANEPPHAFAERHARTFEEAWRRLAVEPDLFVRTTAPAHAKVVSDCLTRLFEAGEIYLAD
YEGLYSVGQERFVTDKELVNGKLPEDKEPPVLRREPNYFFRMEAHRDWMRQLLLDTPDLI
QPAHYRNEILKLLEEPIGDLSISRPVDRLDWGIPIPWNAEHVTYVWFDALLSYISPLGYP
EQSVFGDYWPSVRHVIGKDILRTHTLFWLSMTHALGIPPYRRLHVSGHLLGADGRKMSKS
LGNGVDPLEAADMYGVDTLRYTLIREVSFGFDGIISHAVIEQRLNRDLADDLGNLVARTL
AMVTRYRGGTVPAPKANEAPEERIIARASELPATVLALVDEMKPGGAAKRVMEFVTELNG
YVASRAPWGLAKDAEASDRLDTVLYTLVEAIHGVSNLLSPVMPGKMAELRSLLGAPAELR
WGLPWGHGVKPGSKIREGILFPKRTSTDTVTA
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatcgttacatcaccacgccaatttactatgtgaacgatcgcccccatctgggc
catgcctacgccagcgtacatgccgacatcatggcccgttacctgcgggccgccggacat
gaggtactgctgctcaccggcgcggacgagcacggcgaaaaaatcgccaaggccgcgatg
ctggccaacgaaccgcctcacgcgttcgcggaacgccacgcacggacgtttgaagaagcc
tggcggcgcttggccgtggaaccggacctgttcgttcgcaccaccgcgcccgcacacgcc
aaggtcgtctccgattgcctgacgcggctcttcgaggccggagaaatctatctggccgac
tacgaaggactttattcggtcggccaggagcgcttcgtcacggacaaggaactggtgaac
ggcaagcttcccgaggacaaggagccgccggtgttgcggcgcgaacccaactatttcttc
cgcatggaggcccaccgtgactggatgcgccaattattgctggacaccccggacctgatt
cagcctgcgcactatcgcaacgaaatcctgaagctgctggaagagccgataggtgacttg
agcatctctcgtccggtggatcggctcgactggggcatcccgattccgtggaatgccgaa
cacgtcacctacgtctggttcgacgcactgctcagctacatttcaccgctcggctatccc
gagcaatccgtcttcggtgattactggccatcggtgcggcacgtcatcggcaaagacatc
ctgcgtacgcataccctgttctggctgagcatgacgcatgcgctgggaatccctccgtat
cgacgcttgcacgtctccggacacctgctcggcgccgacggccggaagatgagcaaatcg
ctcggcaacggcgtcgatccgctggaggcggcggacatgtacggcgtcgatacgctgcgc
tacacgctgattcgcgaggtcagctttggttttgacggaataatcagtcacgccgtgatt
gaacagcggctgaaccgcgacctcgccgacgacttgggcaacctcgtggcccgcacgctt
gccatggtgacgcggtaccgcggcggaacggtgcctgcgccgaaggcgaacgaggcgccg
gaagaacggatcatcgcgcgggcgagcgagctgccagccaccgttctggcgctggtcgac
gagatgaaaccgggcggtgccgcgaagcgggtgatggagttcgtaaccgagctgaacggc
tacgtcgcgagtcgcgcgccatgggggctggcgaaagacgccgaggcgtccgaccggctg
gatacggtgctgtatacgctggtggaagcgatccacggtgtgtccaacctgctttccccg
gtgatgcccggcaagatggccgagctgcgatcgctgctcggcgcccccgctgaattgcgc
tggggcttgccgtggggccatggcgtgaagccgggaagcaaaatcagggagggcatccta
tttccgaaacggacgagcacggacaccgtaacggcatga

DBGET integrated database retrieval system