KEGG   Burkholderia glumae PG1: BGL_1c21770Help
Entry
BGL_1c21770       CDS       T03632                                 

Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bgp  Burkholderia glumae PG1
Pathway
bgp00071  Fatty acid degradation
bgp00072  Synthesis and degradation of ketone bodies
bgp00280  Valine, leucine and isoleucine degradation
bgp00310  Lysine degradation
bgp00362  Benzoate degradation
bgp00380  Tryptophan metabolism
bgp00620  Pyruvate metabolism
bgp00630  Glyoxylate and dicarboxylate metabolism
bgp00640  Propanoate metabolism
bgp00650  Butanoate metabolism
bgp00900  Terpenoid backbone biosynthesis
bgp01100  Metabolic pathways
bgp01110  Biosynthesis of secondary metabolites
bgp01120  Microbial metabolism in diverse environments
bgp01130  Biosynthesis of antibiotics
bgp01200  Carbon metabolism
bgp01212  Fatty acid metabolism
bgp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BGL_1c21770
   00630 Glyoxylate and dicarboxylate metabolism
    BGL_1c21770
   00640 Propanoate metabolism
    BGL_1c21770
   00650 Butanoate metabolism
    BGL_1c21770
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BGL_1c21770
   00072 Synthesis and degradation of ketone bodies
    BGL_1c21770
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BGL_1c21770
   00310 Lysine degradation
    BGL_1c21770
   00380 Tryptophan metabolism
    BGL_1c21770
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BGL_1c21770
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BGL_1c21770
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BGL_1c21770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgp04147]
    BGL_1c21770
Enzymes [BR:bgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BGL_1c21770
Exosome [BR:bgp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BGL_1c21770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJK46686
UniProt: A0A0B6S375
Position
1:complement(2517731..2518915)
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGGFGGSLKDFAPTALGARVLREALERAGVAGDEVGHVVFGNVVHT
EPKDMYLARVAAIEGGVSQHVPALTVNRLCGSGLQAIVSAAQSVLLGDAEIAVAGGAESM
SRAPYSMPAARFGQRMGDVKVVDMMLGALSDPFQAIPMGVTAENVAAKYGITREAQDALA
LESHRRASHATKAGYFKTQILPIEIGSKRGTVTFDSDEHVRHDAAAGDFAKLRPVFAKEN
GTVTAGNASGINDAAAAVTLMERRVAEARGLKPLARLVAYAHAGVDPAYMGIGPVPATRK
ALERAGIGVAELDVIEANEAFAAQACAVANELGFDPAKVNPNGSGISLGHPIGATGALIT
VKALYELHRISGRYALVTMCIGGGQGIAAVFERI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgaagtggtggtggtcagcggggtacgtaccgcaatcggcgggttcggcggc
agcctgaaggatttcgcgccgacggcgctcggcgcgcgcgtgctgcgcgaggcgctggag
cgcgcgggcgtggcgggcgacgaggtcgggcacgtggtgttcggcaacgtggtccacacc
gagccgaaggacatgtatctggcgcgcgtggcggcgatcgagggcggcgtctcgcagcac
gtgccggcgctcacggtgaaccggctgtgcggctcgggcctgcaggcgatcgtctcggcg
gcgcagagcgtgctgctcggcgacgccgagatcgcggtggcgggcggcgcggagagcatg
agccgcgcgccgtattcgatgccggcggcgcgcttcgggcagcgcatgggcgacgtgaag
gtggtcgacatgatgctcggcgcgctcagcgatccgtttcaggcgatccccatgggcgtg
acggccgagaacgtggcggcgaagtacggcatcacgcgcgaggcacaggacgcgctcgcg
ctcgaatcgcaccgccgcgcctcgcacgcgacgaaggccggctacttcaagacccagatc
ctgccgatcgagatcggctcgaagcgcggcaccgtcacgttcgactccgacgagcacgtg
cgccacgacgcggcggccggggatttcgcgaagctgcgcccggtgttcgccaaggagaac
ggcacggtgacggccggcaacgcgtctggcatcaacgatgcggcggccgccgtcacgctg
atggagcggcgcgtggccgaggcgcgcggcctgaagccgctggcgcggctggtggcctac
gcgcatgcgggcgtcgatccggcctacatgggcatcggcccggtgccggccacgcggaag
gcgctcgagcgcgcgggcatcggcgtggccgagctcgacgtgatcgaggcgaacgaggcg
ttcgcggcgcaggcttgcgcggtcgcgaacgaactgggcttcgacccggcgaaggtgaat
ccgaacggctcgggcatctcgctcggccatccgatcggcgcgacgggcgcgctgatcacc
gtcaaggcgctctacgagctgcaccggatctcgggccgctacgcgctggtgacgatgtgc
atcggcggcgggcagggcatcgccgccgtgttcgaacgtatctga

DBGET integrated database retrieval system