KEGG   Burkholderia plantarii PG1: BGL_1c30840Help
Entry
BGL_1c30840       CDS       T03632                                 

Gene name
kynA
Definition
(GenBank) tryptophan 2,3-dioxygenase KynA
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00380  Tryptophan metabolism
bgp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BGL_1c30840 (kynA)
Enzymes [BR:bgp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     BGL_1c30840 (kynA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: AJK47560
UniProt: A0A0B6S2J7
Position
1:3542835..3543740
Genome map
AA seq 301 aa AA seqDB search
MSSQPPQAGAPDAARCPFSGEPAAAPAGPEGWHDAQLDFSKSMSYGDYLSLGPILTAQHP
LSPDHNEMLFIIQHQTSELWMKLALYELRAALASIRGDALPPAFKMLARVSRILEQLVQA
WNVLATMTPSEYSAMRPYLGASSGFQSYQYRQLEFLLGNKNAQMLKPHAHRPEILAEVEA
TLDAPSLYDEVVRLLARRGFPIAAERLARDWRAPTTHDVSVEAAWLAVYREPSAHWDLYE
MAEELVDLEDAFRQWRFRHVTTVERIIGFKQGTGGTNGAPYLRKMLDVVLFPELWHVRTT
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccaaccaccgcaagcgggcgcacccgacgccgcgcgctgcccgttctcgggc
gagccggccgccgcgccggccggccccgagggctggcacgacgcccagctcgacttctcg
aagtcgatgagctacggcgattacctctcgctcggcccgatcctcacggcccagcatccg
ctctcgcccgaccacaacgagatgctgttcatcatccagcatcagaccagcgaactctgg
atgaagctcgcgctctacgaactgcgcgcggcgctcgcctcgatccgcggcgacgcgctg
ccgcccgcgttcaagatgctcgcgcgcgtctcgcggatcctcgaacagctggtgcaggcc
tggaacgtgctggccaccatgacgccgtccgagtattcggcgatgcggccttacctcggc
gcgtcgtcgggcttccagtcgtaccagtaccggcagctcgaattcctgctcggcaacaag
aacgcgcagatgctgaagccgcatgcgcaccggcccgagatcctggccgaggtcgaggcc
acgctcgacgcgccgtcgctctacgacgaggtggtgcgcctgctcgcgcgacgcggcttc
ccgatcgcggccgaacggctcgcgcgcgactggcgcgcgccgaccacgcacgacgtgtcg
gtcgaggcggcctggctcgccgtctaccgcgagccgtcggcgcactgggatctgtacgag
atggccgaggaactcgtcgacctcgaggatgcgtttcgccagtggcgcttccgccacgtc
acgacggtcgagcgcatcatcggcttcaagcagggcacgggcggcaccaacggcgcgccc
tatctgcgcaagatgctcgacgtggtgctgtttccggaactctggcacgtccgcacgacg
ctgtaa

DBGET integrated database retrieval system