KEGG   Burkholderia plantarii PG1: BGL_1c34250Help
Entry
BGL_1c34250       CDS       T03632                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase BioF
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00780  Biotin metabolism
bgp01100  Metabolic pathways
Module
bgp_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BGL_1c34250 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgp01007]
    BGL_1c34250 (bioF)
Enzymes [BR:bgp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     BGL_1c34250 (bioF)
Amino acid related enzymes [BR:bgp01007]
 Aminotransferase (transaminase)
  Class II
   BGL_1c34250 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AJK47899
UniProt: A0A0B6S0J2
Position
1:3931588..3932790
Genome map
AA seq 400 aa AA seqDB search
MSPPPNLLAVLERGLAEIDAQGLRRVRRTADTACGAHMTVDGREIVGFASNDYLGLAAHP
LLVEAFAEGARRYGSGSGGSHLLGGHSRAHAALEDALAEFAGGFSGAPRALYFSTGYMAN
LAALTALVGRGAAIFSDSLNHASLIDGARLSRAEIHVYPHGDMDALSVQLAASDAEIKLI
VSDTVFSMDGIIAPLARLVTLAEAHGAWLVVDDAHGFGVLGPQGRGALAEYALHSEQLIY
VGTLGKAAGVAGAFVIAHETVIEWMIQRARSYIFTTAAPPSVAHAVSASLAVIGGAEGDA
RRAHLAALIERTRAILRGTRWQPIDSATAVQPLVIGENEATLAAMRALDAHGLWVPAIRP
PTVPAGTSRLRISLSAAHSFDDLARLDTALAAAGAAEAAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgccgccgaacctgctcgccgtgctcgaacgcggcctggccgagatcgacgcg
cagggcctgcgccgcgtgcgccgcaccgccgacacggcgtgcggcgcgcacatgacggtg
gacggccgcgagatcgtcggtttcgcgagcaacgattatctgggcctggccgcgcatcct
ttgctcgtcgaggcattcgccgagggtgcacggcgctacggctccggcagcggcggctcg
cacctgctgggcggccattcgcgcgcgcacgccgcgctcgaggacgcgctcgccgaattc
gccggcggcttcagcggcgcgccgcgcgcgctctacttcagcaccggctacatggcgaac
ctcgccgcgctgaccgcgctggtggggcgtggcgccgcgatcttctccgattcgctgaac
cacgcctcgctgatcgacggcgcgcggctctcgcgcgccgagatccacgtctatccgcac
ggcgacatggacgcgctgtcggtgcagctggccgcctccgacgccgagatcaagctgatc
gtctccgacaccgtgttcagcatggacggcatcatcgcgccgctggcgcggctcgtcacg
ctggccgaggcgcacggcgcctggctggtggtggacgacgcgcacggcttcggcgtgctc
ggcccgcaggggcgcggcgcgctggccgaatacgcgctgcactccgagcagctgatctac
gtcggcacgctcggcaaggccgccggcgtggccggcgcgttcgtgatcgcgcacgagacc
gtgatcgagtggatgatccagcgcgcgcgcagctacatcttcaccaccgccgcgccgccc
tcggtcgcgcacgccgtgtcggccagcctcgccgtgatcggcggtgccgagggcgacgcg
cggcgcgcccacctggccgcgctgatcgagcgcacgcgcgcgatcctgcgcggcacgcgc
tggcagccgatcgattcggccaccgcggtgcagccgctcgtgatcggcgagaacgaggcc
acgctcgccgcgatgcgcgcgctcgacgcgcacggcctgtgggtgcccgcgatccggccg
cccaccgtgccggccggcacctcgcggctgcgcatctcgctgtccgccgcgcattcgttc
gacgacctggcacggctcgacacggcgctcgccgccgccggcgccgcggaggccgccgca
tga

DBGET integrated database retrieval system