KEGG   Burkholderia plantarii PG1: BGL_2c06910Help
Entry
BGL_2c06910       CDS       T03632                                 

Gene name
aldA
Definition
(GenBank) lactaldehyde dehydrogenase AldA
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00620  Pyruvate metabolism
bgp00630  Glyoxylate and dicarboxylate metabolism
bgp01100  Metabolic pathways
bgp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BGL_2c06910 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    BGL_2c06910 (aldA)
Enzymes [BR:bgp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     BGL_2c06910 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     BGL_2c06910 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AJK48775
UniProt: A0A0B6S658
Position
2:complement(860484..861920)
Genome map
AA seq 478 aa AA seqDB search
MSSTPTQYQHYIDGEFTSSSEHFEVRNPATGALLSHAPVAGDADLAHAIDAARRAQAGWA
RTTPVERARFLHQIADALRADVARLADVIVNEGGKIRGLAEVEVNFTADYLDYMAEWARR
IEGEIIPSDRANETMLLFRKPMGVVAGILPWNFPFFLIARKMAPALVTGNTIVIKPSEET
PNNCFEFAKIVAKTALPRGVFNVVAGRGDVGAKLSAHAGVDMISFTGSVATGQRIMAAAA
PNLTKLNLELGGKAPAIVLADADLDLAVTAIRNSRVINTGQVCNCAERVYVERPIAEAFI
ERISAAMRATRYGDPVADANVEMGPLINQLGLDKVAAKVKTAVEQGGTVVTGGKLADLGR
GFHYEPTVIADCREDMAIMREEIFGPVLPIQIVDDLDHAIALANDCEYGLTSSVYTKSLN
SAMAAIRGLSFGETYVNRENFEAMQGFHAGVRKSGIGGADGKHGVYEYTHTQVVYLQT
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcactccgacgcaataccagcactacatcgacggtgaattcaccagctcgtcc
gagcacttcgaagtccgcaacccggccaccggcgcgctgctctcgcacgcgccggtggcc
ggcgacgccgacctggcccacgcgatcgacgccgcgcgccgcgcgcaggccggctgggcg
cgcaccacgccggtggagcgcgcgaggttcctgcaccagatcgccgacgcgctgcgcgcc
gacgtggcgcggctcgccgacgtgatcgtcaacgagggcggcaagatccgcggcctggcc
gaggtcgaggtcaacttcaccgccgactatctcgactacatggccgagtgggcgcgccgc
atcgagggcgagatcatcccgagcgaccgcgccaacgaaaccatgctgctgttccgcaag
ccgatgggcgtggtggccggcatcctgccgtggaacttcccgttcttcctgatcgcgcgc
aagatggcgcccgcgctcgtgaccggcaacaccatcgtgatcaagccgagcgaggaaacg
ccgaacaactgcttcgagttcgcgaagatcgtcgcgaagacggcgctgccgcgcggcgtg
ttcaacgtggtggccgggcgcggcgacgtgggcgcgaagctcagcgcgcacgccggggtg
gacatgatcagcttcaccggcagcgtggccaccggccagcgcatcatggccgccgccgcg
ccgaacctcaccaagctcaacctcgaactgggcggcaaggcgcccgcgatcgtgctggcc
gacgccgatctcgacctcgccgtcaccgcgatccgcaactcgcgcgtgatcaacacgggg
caggtctgcaactgcgccgagcgcgtctacgtggagcggccgatcgccgaggcgttcatc
gagaggatcagcgcggcgatgcgcgccacgcgctacggcgacccggtggccgacgcgaac
gtcgagatgggcccgctcatcaaccagctcggcctcgacaaggtggccgcgaaggtgaag
acggccgtcgagcagggcggcacggtggtgacgggcggcaagctggccgaccttggccgc
ggcttccactacgagccgacggtgatcgccgactgccgcgaggacatggcgatcatgcgc
gaggagatcttcgggccggtgctgccgatccagatcgtcgacgatctcgaccacgcgatc
gcgctcgccaacgactgcgaatacgggctcacctcgtcggtctacacgaagagcctgaac
agcgcgatggcggcgatccgcgggctgtcgttcggcgagacctacgtcaatcgcgagaac
ttcgaggcgatgcagggcttccacgccggcgtgcgcaagagcggcatcggcggcgcggac
ggcaagcacggcgtgtacgaatacacccacacgcaggtcgtgtatctgcagacctga

DBGET integrated database retrieval system