KEGG   Burkholderia plantarii PG1: BGL_2c13290Help
Entry
BGL_2c13290       CDS       T03632                                 

Definition
(GenBank) ABC-type sugar transport system, ATPase component
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BGL_2c13290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgp02000]
    BGL_2c13290
Enzymes [BR:bgp01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     BGL_2c13290
Transporters [BR:bgp02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    BGL_2c13290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_30 RsgA_GTPase SMC_N Zeta_toxin AAA_29 AAA_25 AAA_23 MMR_HSR1 IMPDH
Motif
Other DBs
NCBI-ProteinID: AJK49396
UniProt: A0A0B6SAY8
Position
2:complement(1662207..1663715)
Genome map
AA seq 502 aa AA seqDB search
MIQTPMLEMTGIDKTFPGVKALQQVNFRLFPGEVHTLMGQNGAGKSTLINVLTGVLAHDG
GEIRLGGEPVRFAAPIEAEAAGIQTIYQEVNLCPNLSVAENIFAGRQPVRRGAIDWRTIR
TRAREILAGLNLTIDVTRSLEAYPIAVQQMVAIARAVSVEARVLILDEPTSSLDDGEVER
LFAVLRQLKASGMAILFVTHFLEQTYAVSDRITVMRNGEREGEYLARDLPMDELVARMTG
HVRMSERLKDGDGARAEHRTAPFLTMQGVGRRGLMHPLDLAIRPGEILGLAGLLGSGRTE
TARLVFGAERADSGRMTVGGDAVKLSSPRDGVRHGIAYCPEDRKKEGIVAALSIRENIVL
ALQARLGWWRMMSLARQRELAQRYIAQLGIKARDAEQPIGLLSGGNQQKVLLARWLATEP
KLLILDEPTRGIDVAAKFDIMDRVLALCAKGLSILFISSDVGEVVRVSHRIAVLRDRHKV
AEVAGESLSEDEVYRLIAGGQS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgatccagacacccatgctggaaatgaccgggatcgacaagacgttcccgggcgtgaag
gcgttgcagcaggtgaatttccggctgttccccggcgaggtccatacgctgatgggccag
aacggcgcgggtaaatcgacgctcatcaacgtgctgaccggcgtgctcgcgcacgacggc
ggcgagatccggctgggcggcgagccggtgcggttcgccgcgccgatcgaggccgaggcg
gccgggatacagacgatctatcaggaggtcaatctgtgtccgaacctctcggttgccgag
aacatcttcgccgggcggcagccggtcaggcgcggcgcgatcgactggcggacgatccgc
acgcgcgcccgcgagattctcgccggcctgaacctgaccatcgacgtgacccgctcgctc
gaggcgtatccgattgccgtccagcagatggtggcgatcgcgcgggccgtctcggtggag
gcgcgcgtgctgatcctcgacgagccgacctcgagcctcgacgatggagaggtcgagcgg
ctgttcgcggtgctgcggcaattgaaggcgtcaggcatggcgatcctgttcgtgacgcac
ttcctcgagcagacctacgcggtgtccgaccggatcacggtgatgcgcaacggcgagcgg
gaaggcgaatacctggcccgggacctgccgatggacgaactggtcgccaggatgaccggg
cacgtccgcatgagcgagcgcctgaaggacggcgacggcgcgcgcgccgagcaccggacg
gcgccgtttctcacgatgcagggcgtcggccgccggggcctgatgcatccgctcgatctc
gccatccggccgggtgagatcctgggtctggcggggctgctcggctcgggccgcaccgag
accgcgcggctggtgttcggcgcggagcgcgccgacagcggccgcatgacggtgggcggc
gacgcggtgaagctttcgtcgccgcgcgacggcgttcggcacggtatcgcctattgcccc
gaggaccgcaagaaggaaggcatcgtcgcggcgctgtcgatccgcgagaacatcgtgctc
gcgctgcaggcccggctcggctggtggcgcatgatgagcctcgcgcgccagcgcgagctg
gcgcagcgatacatcgcgcagctcggcatcaaggcccgcgacgcggagcagccgatcggg
ctgctctcgggaggcaaccagcagaaggtgctgctggcccgctggctcgccaccgagccg
aagctgctgattctcgacgagcccacgcgcggcatcgacgtcgccgcgaaattcgacatc
atggatcgcgtgctcgcgctttgcgccaagggtctctcgattctcttcatctcctcggac
gtcggcgaagtggtgcgcgtcagccaccggatcgcggtgctgcgcgaccggcacaaggtg
gccgaggtggcgggcgagtcgctgtcggaggacgaggtctatcggctcatcgcgggaggc
cagtcatga

DBGET integrated database retrieval system