KEGG   Burkholderia plantarii PG1: BGL_2c22010Help
Entry
BGL_2c22010       CDS       T03632                                 

Gene name
manC2
Definition
(GenBank) mannose-1-phosphate guanylyltransferase ManC
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
bgp  Burkholderia plantarii PG1
Pathway
bgp00051  Fructose and mannose metabolism
bgp00520  Amino sugar and nucleotide sugar metabolism
bgp01100  Metabolic pathways
bgp01110  Biosynthesis of secondary metabolites
bgp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BGL_2c22010 (manC2)
   00520 Amino sugar and nucleotide sugar metabolism
    BGL_2c22010 (manC2)
Enzymes [BR:bgp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BGL_2c22010 (manC2)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     BGL_2c22010 (manC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AJK50262
UniProt: A0A0B6RY15
Position
2:2821107..2822693
Genome map
AA seq 528 aa AA seqDB search
MNPPSAVGLAPNAAAPSAAPAPASAPTAAPAGGTPQGAATAARVAVQPVVLAGGSGTRLW
PMSREQFPKQLIGLLGDESLLQSTTRRLEGYDGDHPVSERLMVVCGDDHRFTTAEQLRLV
GKDASIVLEPFGRDTAPALTIAALRVVAEQGDAVMTVMPADHAVADLARFQASLDAGIRH
AMQGRIATMGILPTHAETGYGYIRVGSVIDAAGEGAVEVRKLARFVEKPHLELAQQYVSA
GDYWWNSGIFIVRASVWLKAIRHFQPAIHEACAQAVALGDDDGTFFRLHRESFAASPANS
IDYSVMEPLVNAPEVCESVVVPLDAGWSDVGSWDALWQISEKDEGGNVARGPVMLEGAAS
TFAHSEGRLIACVGTRDLIVVETPDAVLVADKARVQDVKKIVGRLKGDARVEASNHRKVH
RPWGHYDSVDMGERFQVKRIVVKPGAQLSLQMHHHRAEHWIVVCGTARITRGEDTFLLSE
NESTYIPLGVTHRLENPGKMPLELIEVQSGSYLGEDDIVRFDDTYGRG
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctccctccgccgtcggcctcgcgccgaacgccgccgcgccgtccgcggccccc
gcccccgcctccgcccccaccgccgcgcccgcgggcggcacgccccagggcgccgcgacg
gccgcccgcgtggccgtgcagccggtggtgctggcgggcggttccggcacgcgtctctgg
ccgatgtcgcgtgaacagttcccgaaacagctgatcggcctgctcggcgacgaatcgctg
ctgcagtcgaccacgcgccgcctcgaaggctatgacggcgatcatccggtctccgaacga
ctgatggtggtgtgcggcgacgatcaccgcttcacgaccgccgagcagctgcgcctggtg
ggcaaggacgcgtcgatcgtgctcgagccgttcggccgcgacaccgcgccggcgctgacg
atcgcggcgctgcgcgtggtcgccgagcagggcgatgcggtgatgacggtgatgcccgcc
gaccatgcggtggccgacctcgcgcgcttccaggcctcgctcgacgccggcatccgccac
gcgatgcagggccggatcgccaccatgggcatcctgccgacgcatgccgaaaccggctac
ggctacatccgcgtgggcagcgtgatcgacgccgccggcgaaggcgcggtggaagtccgc
aagctcgcgcgcttcgtcgaaaaaccgcatctggaactggcgcagcaatacgtgagcgcc
ggcgactactggtggaacagcggcatcttcatcgtgcgcgcgtcggtctggctcaaggcg
atccgccacttccagcccgccatccacgaggcctgcgcgcaggcggtggcgctcggcgac
gacgacggcacgttcttccgcctgcaccgcgagagcttcgcggcctcgccggcgaactcg
atcgactattcggtgatggagccgctcgtcaacgcgccggaggtctgcgaaagcgtggtc
gtgccgctcgacgcgggctggtccgacgtcggctcgtgggacgcgctctggcagatctcc
gagaaggacgaaggcggcaacgtggcgcgcgggccggtgatgctcgagggcgcggcgtcc
accttcgcgcactccgagggccggctgatcgcctgcgtcggcacccgcgacctgatcgtg
gtcgaaacgcccgacgcggtgctggtggccgacaaggcgcgcgtgcaggacgtcaagaag
atcgtcggccgcctgaagggcgacgcgcgcgtggaggcgtcgaaccaccgcaaggtgcat
cgcccgtggggccactacgattcggtcgacatgggcgagcgctttcaggtcaagcggatc
gtcgtgaagccgggcgcgcaactctcgctgcagatgcaccaccaccgcgccgagcactgg
atcgtggtgtgcggcacggcgcgcatcacgcgcggcgaggacacgttcctgctgtccgag
aacgaatcgacctatatcccgctcggcgtcacgcaccggctcgagaatcccggcaagatg
ccgctcgaactgatcgaggtgcagtcggggtcgtatctcggcgaggacgacatcgtccgc
ttcgacgacacctacggccgcggctga

DBGET integrated database retrieval system