KEGG   Bradyrhizobium guangdongense: X265_05245Help
Entry
X265_05245        CDS       T05902                                 

Definition
(GenBank) hypothetical protein
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bgq  Bradyrhizobium guangdongense
Pathway
bgq00790  Folate biosynthesis
bgq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    X265_05245
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgq04147]
    X265_05245
Enzymes [BR:bgq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     X265_05245
Exosome [BR:bgq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   X265_05245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: QAU37158
UniProt: A0A410V0H8
Position
complement(1083637..1083804)
Genome map
AA seq 55 aa AA seqDB search
MDHHPRWENIWRSVDVHLSTWDIGHKPSVMDLELAQYLEEVRSRFPPPKIRAKNP
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atggatcatcacccacgctgggaaaacatctggcgctctgtcgatgtgcatttgtctaca
tgggatatcggccataagccgtcggtgatggatctcgagttggcgcagtaccttgaagag
gtgcgcagcaggttcccccctccaaaaatcagggcgaagaacccgtag

DBGET integrated database retrieval system