KEGG   Bradyrhizobium guangdongense: X265_24740Help
Entry
X265_24740        CDS       T05902                                 

Definition
(GenBank) histidine phosphatase family protein
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
bgq  Bradyrhizobium guangdongense
Pathway
bgq00860  Porphyrin and chlorophyll metabolism
bgq01100  Metabolic pathways
Module
bgq_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bgq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    X265_24740
Enzymes [BR:bgq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     X265_24740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: QAU40524
UniProt: A0A410VA56
Position
5127120..5127692
Genome map
AA seq 190 aa AA seqDB search
MEGETFLWLIRHAPVDGAAGTIHAADAPADLGDHSQLEALRRCLPRDAASYASPARRTVE
TARALGLEPELVPAFGEQDFGDWTGHRHDELAATGGAAYAQFWSDPARGRPPDGESFEDQ
VARVRQGFAEIGAGPATLVVHSGTIRAALCIALDLTPQAALRFVVDPLSLTRIDRLATGW
RVVSVNQQVS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcgagaccttcctctggctgatacgtcatgcgccggtcgacggtgccgctggc
accatccatgcggccgacgcgccggccgatctcggcgatcactcgcaactagaggcgctg
cgccggtgcttgccgcgcgatgcagcgagttatgcgagcccggcgcgacgcaccgtcgag
accgcacgcgccctggggctcgagcctgagctggtgcccgcgttcggcgagcaggatttt
ggcgactggaccgggcatcgccatgacgagctcgccgcaaccggtggcgcggcttacgcg
caattctggagcgatccggcgcgtggacgaccgcctgacggagaaagttttgaagatcag
gtcgcgcgcgtccggcaaggcttcgcggagattggcgcaggcccggcaacgctggtcgtg
cattccggcaccatccgcgccgcgctttgcatcgcgcttgacctgacgccgcaggcggcg
ttgcgcttcgtcgtcgatccgttgtcgttgacccggatcgaccgcctcgcaaccggctgg
cgtgtcgtgtcggtcaatcagcaggtcagctag

DBGET integrated database retrieval system