KEGG   Bradyrhizobium guangdongense: X265_35075Help
Entry
X265_35075        CDS       T05902                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bgq  Bradyrhizobium guangdongense
Pathway
bgq00061  Fatty acid biosynthesis
bgq00071  Fatty acid degradation
bgq01100  Metabolic pathways
bgq01212  Fatty acid metabolism
bgq02024  Quorum sensing
Module
bgq_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bgq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    X265_35075
   00071 Fatty acid degradation
    X265_35075
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    X265_35075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bgq01004]
    X265_35075
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgq04147]
    X265_35075
Enzymes [BR:bgq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     X265_35075
Lipid biosynthesis proteins [BR:bgq01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   X265_35075
Exosome [BR:bgq04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   X265_35075
  Exosomal proteins of breast cancer cells
   X265_35075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: QAU42322
UniProt: A0A410VF87
Position
7307487..7309037
Genome map
AA seq 516 aa AA seqDB search
MYPGLHARLRPLQPAFIMAATGEAVTYRELEARSNRLAHLLRKHGLKRLDHYSIFMENNS
RYLEACGAGERSGLYYTCINSFLTPGELAYLLVNSQSKILITSVAKLDIAREAIQACPEI
KLCIVADGPGESDRIVGLADVTAELPKTPIADEWLGTAMLYSSGTTGRPKGILRPLPEEP
PKHNLPLFDFLTKLWHYREGMVYLSPAPLYHSAPQAAVNLTIRMGGTVIIMEHFDPERYL
QLVEQWGITHSQLVPTMFSRMLKLPEDARKRYDLSSLEIAIHAAAPCPALVKDDMIKWWG
PIIHEYYGATEGLGFTACNSEEWLSHRGTVGKVLLGDLHILDENMRECPTGTPGQVWFKT
ASPFEYFNDPEKTREARSADGSMSTVGDVGYVDEDRFLYLTDRATFMIISGGVNIYPQEC
ENLLITHPKVADAAVFGVPNADLGEEVKAVVQPMPGVVPGPALAEELIAFCGQSLSRQKV
PRSVDFEKELPRLPTGKLYKRLLRDRYWGNKTSRIV
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtacccaggtctgcatgctcgactgcgcccgctgcaacccgccttcatcatggccgcg
acgggcgaggccgtcacctaccgcgagctggaggcgcgcagcaatcgcctcgcgcatctg
cttcgcaagcatggcttgaagcggctcgatcactactcgatcttcatggagaacaattcg
cgctatctcgaagcctgcggcgcgggcgagcggtccggcctttactacacgtgcatcaac
tccttcctgacgcccggcgagctggcctatctcctcgtcaacagtcagtccaagatcctg
atcacctcggtggccaagctcgacatcgcgcgggaggcgatccaggcctgccccgagatc
aagctctgcatcgtcgccgacggccccggcgagagcgaccgcatcgtcgggctggctgat
gtcaccgccgagctgccgaaaacgccgatcgccgatgagtggctcggcaccgcgatgctc
tactcgtcgggcacgaccggacggccgaaaggcatcctgcggccactgccggaggagccg
ccgaaacacaatctgccgctgttcgatttcctgaccaagctttggcactaccgcgagggc
atggtctatctgtcgccggcaccgctctatcattcggcgccgcaggccgcggtcaatctg
acgatccgcatgggcggcaccgtgatcatcatggagcatttcgatcccgagcgttacctc
cagctcgtcgaacaatggggcatcacgcacagccagctggtgccgacgatgttctcgcgc
atgctcaagctgcccgaggacgcgcgaaagcgttacgatttgtcctcgctggagatcgcg
atccatgccgcggcgccttgtccggcgctggtcaaggacgacatgatcaaatggtggggg
ccgatcatccacgaatattacggcgcgaccgaagggctcggcttcacggcctgcaacagc
gaggaatggcttagccaccgcggcaccgtcggcaaggtgctgctcggcgacttgcatatt
ctcgacgagaacatgcgggaatgcccgaccggcacgccgggccaggtctggttcaagacg
gcgtcgccgttcgagtatttcaacgatccggagaagaccagggaggcgcgctcggccgat
ggcagcatgagcacggtcggggatgtcggctatgtcgatgaggaccgcttcctctatctc
accgaccgcgccactttcatgatcatctccggcggcgtgaacatctatccgcaggaatgc
gagaatctactgatcacccatcccaaggtggcggacgcggcggtgttcggcgtgcccaat
gccgatctcggcgaagaggtgaaggcggtggtgcagccgatgcccggcgtggtgccgggg
cccgcgctggcagaggaactgattgctttctgcgggcagtcactgtcgcggcagaaggtg
ccgcgctcggtcgatttcgagaaggaattgccgcggctgccgacggggaagctgtacaag
cggctgctgagggatcggtactggggcaacaagacgtcgcggatcgtgtga

DBGET integrated database retrieval system