KEGG   Bradyrhizobium guangdongense: X265_38590Help
Entry
X265_38590        CDS       T05902                                 

Definition
(GenBank) phosphotransferase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bgq  Bradyrhizobium guangdongense
Pathway
bgq00627  Aminobenzoate degradation
bgq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgq00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    X265_38590
Enzymes [BR:bgq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     X265_38590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 DUF4262
Motif
Other DBs
NCBI-ProteinID: QAU43536
UniProt: A0A410VIN9
Position
unnamed:603979..604803
Genome map
AA seq 274 aa AA seqDB search
MAKSGTQLQWPEIAGVISDLDGVVYRGNAAIADAIEAFKSWQRAKLPFCFVTNNSTHTPE
DVVRKVGGFGLSISPRQVVTSAITAAALIRAQYPKLTRAFVIGAPSLAKAIEEAGLEVTD
AKPEVVVMGLDRQITHDKLRIAAAAILGGAVFIGTNPDLLLPTADGFEPGAGAMITAVAA
ATQVQPLIVGKPETHMIEAALSRLGTPRQSTLMIGDQIQTDIQAGKRAGLPAVLVTTGVP
PRKDAALLPADFTVSSLSEIAVKAGVDTVRQRRA
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggctaagtccggcactcagcttcaatggcccgagatcgccggtgtcatttccgatctg
gatggcgtggtctaccgggggaacgccgcgatcgcggacgccatcgaagccttcaagagc
tggcagcgggcaaaacttcccttctgcttcgtcactaacaattcgacccacacgccggaa
gatgttgtgcgcaaggtcggaggtttcgggctttcgatctccccgaggcaggtcgtgacg
agcgccatcacggccgcggcgctcattcgcgcccaatacccgaaactgacacgggccttt
gtcatcggcgcgccatcccttgccaaagcgatcgaggaggcgggcctcgaagtcaccgat
gcgaagcctgaagtcgtggtgatggggctcgaccgccagattacgcatgacaagctgcga
attgctgctgcggctatcctgggcggcgccgtgttcataggcacaaaccctgatcttctc
ttgccgactgcggacggcttcgaaccaggggcaggggccatgatcacggcagttgcagcc
gcaactcaagtccagcctctgatcgtcggcaaacccgagacgcacatgatcgaagccgcg
ctttcgcggcttggaacgccacgtcaatccacattgatgatcggcgaccagatacagaca
gatatccaggccggcaagcgcgccggccttcctgccgtgctcgtcacgacaggcgtccca
cctcgcaaggacgccgcgctgctgccagccgactttaccgtgtccagcctttcagaaatc
gccgtgaaggctggtgtagacaccgtacggcagaggagagcgtga

DBGET integrated database retrieval system