KEGG   Bartonella grahamii: Bgr_04800Help
Entry
Bgr_04800         CDS       T00922                                 

Gene name
thrC
Definition
(GenBank) threonine synthase ThrC
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bgr  Bartonella grahamii
Pathway
bgr00260  Glycine, serine and threonine metabolism
bgr00750  Vitamin B6 metabolism
bgr01100  Metabolic pathways
bgr01110  Biosynthesis of secondary metabolites
bgr01120  Microbial metabolism in diverse environments
bgr01230  Biosynthesis of amino acids
Module
bgr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bgr_04800 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bgr_04800 (thrC)
Enzymes [BR:bgr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bgr_04800 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACS50806
UniProt: C6AC94
Position
complement(582723..584120)
Genome map
AA seq 465 aa AA seqDB search
MEYISTRGEAPALSFTETIMTGLASDGGLYLPDKFPQLSFDALRALRGQSYTTIAKTILC
PFVNNEIEYTAFENMIAESYATFHHPAICPLRQTGADEFILELFHGPTLAFKDVAMQFLS
RLMDYVLTEKNRCATIIAATSGDTGGAAIQAFAGKEHSDIFILFPKGRVSPVQQRQMTTN
QCSNVHAIAIEGNFDDCQALVKAMFNDHNFRKKRALSGVNSINWARIMAQIVYYFSSALS
LGAPDRAVSFTVPTGNFGDIFAGYVAARMGLPIAQLVIATNDNDILARTLTSGTYETQPI
VHTTSPSMDIQVSSNFERLLFESGNRDPMWIRNAMDNLKQSGRFTLDEKQLKNIRSLFSA
GKSNMAATAQTIDSVYKESGYLVDPHTAVALQVARKNKKPHIPMIVLATAHPAKFPDTIK
SACGLHAPWPSHLNDVMKRKEHFISLANDEKIVKDYISLKSRASY
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggaatatatcagcacgagaggtgaagctcctgctttaagctttacggaaacgatcatg
acaggattggcaagtgatgggggactttatctgccagataaatttcctcagctctcattt
gatgcgttacgagcacttcgtggtcagtcctatacaacaattgctaaaactattctgtgc
ccctttgtaaataacgaaatcgaatatacagcttttgaaaatatgatcgctgaatcttat
gcaacctttcaccatccagcaatctgtccgttacgacaaactggagcagatgaatttatc
cttgaactctttcatggtcctactttagcttttaaagatgtcgcaatgcagtttctttct
cgactgatggattatgttttgactgaaaaaaatagatgtgcaacgattattgctgcaaca
tcaggtgatacaggaggggctgcgatacaagcttttgctggaaaagaacactcagatatt
tttattttatttcctaaaggacgtgtatcacctgttcaacaacggcaaatgacaaccaat
caatgttcaaatgttcatgccattgccattgaaggaaattttgatgattgccaagctctt
gtcaaagcaatgtttaatgaccacaattttcgtaaaaaaagagcgctttcaggtgttaac
tctataaattgggcgcgtatcatggcgcaaattgtttactatttttcatctgcactttcc
ttaggggctcctgatagagctgtttcatttactgttcctactggaaactttggtgatatt
tttgcaggttatgtcgcagcccgtatgggattacccattgctcaactggtcatcgcaacg
aatgataacgacatccttgcacgtacattgaccagcggtacttacgaaacgcaaccaata
gtccatacaacatcaccttctatggatatccaggtctcttctaattttgaacgtttgctc
tttgaaagtggcaatcgtgatccaatgtggattcgcaatgcaatggacaacttgaaacaa
tctggacgttttactcttgatgaaaagcaactcaaaaatattcgttccctattttctgct
gggaaaagcaacatggctgcaacagctcaaacaattgatagtgtctataaggaaagtggc
tatcttgttgatccacatacagccgtcgctcttcaagtagcgcgtaaaaacaaaaaaccg
catattccaatgatcgtccttgccacggctcatccagctaaatttcctgatactattaaa
agtgcttgtggacttcatgccccatggccatctcatctcaatgatgtaatgaaacgcaaa
gaacactttataagtcttgctaatgatgaaaaaatagtaaaagattatatctctttaaaa
tcgcgtgcatcttattaa

DBGET integrated database retrieval system