KEGG   Bartonella grahamii: Bgr_06600Help
Entry
Bgr_06600         CDS       T00922                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bgr  Bartonella grahamii
Pathway
bgr00010  Glycolysis / Gluconeogenesis
bgr00020  Citrate cycle (TCA cycle)
bgr00620  Pyruvate metabolism
bgr01100  Metabolic pathways
bgr01110  Biosynthesis of secondary metabolites
bgr01120  Microbial metabolism in diverse environments
bgr01130  Biosynthesis of antibiotics
bgr01200  Carbon metabolism
Module
bgr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bgr_06600 (pdhC)
   00020 Citrate cycle (TCA cycle)
    Bgr_06600 (pdhC)
   00620 Pyruvate metabolism
    Bgr_06600 (pdhC)
Enzymes [BR:bgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bgr_06600 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 Peptidase_M23 ATP-synt_ab_Xtn QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ACS50974
UniProt: C6ACR2
Position
800189..801532
Genome map
AA seq 447 aa AA seqDB search
MPIKITMPALSPTMEEGNLTKWNIKEGDKVSSGDVIAEIETDKATMEVEAVDEGRVAKIV
VPAGTQGVKVNALIVVLAEEGEDLAEAAKVSEEISSSTRQEPEGVKQTDTLKQTDSKGTK
MSHESSAQQLIQQDKKVARLFASPLARRLASQDGLDLSLISGSGPHGRIIKRDVEKAVSS
DISKVSYSSQIGELVATGASDKQILKLFKEDEYTFAPHNNMRKTIATRLMESKQRVPHFY
VTVDCELDALLALRTQLNAAAPMIKGQEETQPTYKLSVNDMVIKAVALSLKAVPDANVSW
LEGGMLHHKHCDVGVAVSIPNGLITPIIRHAEEKPLSLISKEMKDFAKRAREGKLKMEEY
QGGTTAVSNMGMYGIKSFSAILNPPHATIFAIGAGEERAVVKNGALVVATVMSVTISADH
RAVDGALAAELARAFKKMIENPLAMLV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcccattaaaattacaatgccagcactttcccctacgatggaagagggaaatttaaca
aaatggaatattaaggagggagataaggtttcctctggtgatgttattgctgaaattgag
acggataaagcgacaatggaagtcgaagccgttgatgaaggtagggttgccaaaattgtt
gttcctgctggaacacaaggcgttaaagtaaatgctttaattgttgttttagcagaagaa
ggtgaagatttagctgaagctgcaaaagtttcagaagaaatctcttcttctacaagacaa
gaaccagagggcgtaaaacagacagatactctgaaacagacggactcaaagggtacaaaa
atgtctcatgaatcatcagctcagcaattaatacagcaagataaaaaggtagcgcgtctt
tttgcctctcccttagcgcggcgattagcatctcaggacggccttgatttatcccttatt
tctggaagtggtccgcatgggcgtattatcaagcgcgatgtagaaaaagctgtgagtagt
gatatttctaaagtgtcttattcatcacaaataggggagctagtagctacaggtgcttct
gacaaacagatactgaaactctttaaagaggatgaatataccttcgcaccccataataat
atgcgtaaaacaatcgcaacacgtttgatggaatcaaaacagagagttccacatttctat
gtaacggtagattgtgaacttgatgcgctgttagcactgcgtacacaactgaatgctgct
gcaccaatgattaaggggcaggaagaaactcagcctacttataagctttctgttaatgat
atggtgatcaaagctgtcgcactttctttgaaagctgttcctgatgcgaatgtctcttgg
cttgaaggcggaatgcttcatcataaacattgtgatgttggggttgctgtttctattccc
aatggattaattacgccgattattcgccatgcagaggaaaagccgttatcacttatttcc
aaagagatgaaggattttgcaaagcgtgcgcgtgagggcaagttaaaaatggaggaatat
cagggtggaacaacagctgtatcaaatatggggatgtatggtataaaaagtttttcggct
atccttaatccaccgcatgcaacgatttttgcgattggtgcaggggaagaacgcgccgtt
gttaaaaatggtgcattagttgttgcgacagttatgtcagttacaatttctgcggatcat
cgtgctgtcgatggtgctttagcagcagagctcgcgcgggcttttaagaagatgattgaa
aatccattagcaatgttggtttga

DBGET integrated database retrieval system