KEGG   Bartonella grahamii: Bgr_07200Help
Entry
Bgr_07200         CDS       T00922                                 

Definition
(GenBank) amino acid ABC transporter, permease protein
  KO
K02029  polar amino acid transport system permease protein
Organism
bgr  Bartonella grahamii
Brite
KEGG Orthology (KO) [BR:bgr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bgr02000]
    Bgr_07200
Transporters [BR:bgr02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    Bgr_07200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACS51029
UniProt: C6ACW7
Position
complement(869297..870019)
Genome map
AA seq 240 aa AA seqDB search
MIENLALLSFSNGGWGAVILSSAGMTLSLALCCGLLGLPLGLLNAVMIRSNIKMAKAMAR
LFSTVFRGLPELLTLFLVYYGLQSLIQNVFDYFNFEIMFSINAFVAGVLALSMVLAAFSC
EVWLGAFNIFDKGQYEAAKALGLSRSTTFFRIVFPQLIRNALPGLSNNWLTLLKDTSLVS
TIALVDLMRQTNLAVAATNKPMLFYLVACLLYLLFSAVFTAILRHLETYTQIGDKKVLRQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaaatttagcattgctatcatttagcaatggtggatggggagcggttatactt
tctagtgcaggaatgacattgtcattggcattatgttgtggacttctaggacttcctcta
ggtcttctaaatgcagtgatgattcgatccaatattaagatggccaaagcgatggcacgc
ctcttttcaacggtatttcgtggactaccagagcttttaactttgtttttagtttactac
gggttacaaagccttattcaaaatgtctttgactattttaattttgaaatcatgttcagt
atcaatgcttttgttgctggtgttcttgcgcttagtatggttcttgcagctttttcttgt
gaagtttggcttggagcatttaatatttttgataaaggccaatatgaagcggctaaagct
ttaggcctttcacggtcaaccacattttttcgtattgtcttccctcagctcatccgaaat
gccttgccaggactttctaataactggcttactttactgaaagatacatcccttgtttca
accatcgcacttgttgacctcatgcgacaaacgaacttagctgtcgctgctaccaataaa
cccatgctattttatcttgtagcatgcttactctatttgttattttcagcggtttttact
gcaatcttacgccatttagaaacatacactcaaataggcgataaaaaggtgctacgtcaa
tga

DBGET integrated database retrieval system