KEGG   Bartonella grahamii: Bgr_10810Help
Entry
Bgr_10810         CDS       T00922                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bgr  Bartonella grahamii
Pathway
bgr00450  Selenocompound metabolism
bgr00970  Aminoacyl-tRNA biosynthesis
bgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Bgr_10810 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bgr_10810 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgr01007]
    Bgr_10810 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bgr03016]
    Bgr_10810 (metS)
Enzymes [BR:bgr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Bgr_10810 (metS)
Amino acid related enzymes [BR:bgr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Bgr_10810 (metS)
Transfer RNA biogenesis [BR:bgr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Bgr_10810 (metS)
 Prokaryotic type
   Other AARSs
    Bgr_10810 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DALR_1 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ACS51342
UniProt: C6ADT7
Position
complement(1223325..1224884)
Genome map
AA seq 519 aa AA seqDB search
MRDTYYITTPIFYPNGAPHIGHAYSAIASDVLARFQRLNGKNVFFLSGTDEHGLKMQQTA
AALGMTPQQLADRNSAVFQKMLAVLNCSNDDFIRTTEERHYQACQEIWKKMEANGDIYLG
RYTGWYSVRQEAYYEEKDTEIGPDNIRREKELGSPVEWNEEESYFFRLSHYEKALLEYYE
KHPDFIAPLERRNEIISFIKSGLKDISISRASFNWGIAVPENPKHVMYVWVDALTNYLSA
IGFFNENSKKRDFWPANTHIIGKDIIRFHAVYWPAFLMSAGIELPKNIFAHGFLLNRGAK
MSKSIGNVVDPFEMVDHYGLDQVRYFLLREVPFGQDGSYSHESLVNRINADLANDLGNLA
QRCLSMIAKNCNAQVPRPTSFLAQDKQLLEQSLQVLETVHQAMSSYSMHLALSAIFSIVA
DANRYFANEQPWSLRKNDQERFSTVLYITVEILRRIGIMLLPFIPQSAAKLLDSLAVAED
DRLLYHISHSKIQEGLDLPPPEPIFPRYILKKEDTYHVD
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacacatattacataacaactcccattttttatcctaatggtgctccacatatt
ggacatgcctatagtgcaattgcaagcgatgtcttagcccgctttcaacgattaaacgga
aaaaatgtattttttctttctggtacagatgagcatggtctaaagatgcaacaaaccgca
gcagcattaggcatgacacctcagcaacttgcagatcgtaatagtgctgtgtttcaaaaa
atgcttgcagtattaaattgttctaacgatgattttatccgtacgacagaagaacgccat
tatcaagcttgtcaagaaatttggaaaaagatggaagcaaatggcgatatttatctcggt
cgttatacggggtggtattcggttcgccaagaagcctattatgaagaaaaagatacggaa
attggaccagacaacatccgccgtgagaaagaattaggctctccagttgaatggaatgaa
gaagaaagttatttttttagactttctcattatgaaaaagctcttcttgaatattatgaa
aaacatcctgattttattgctccacttgagcggcgtaatgaaattataagttttatcaaa
tcaggtttaaaagatatctctatttcacgcgcaagttttaactggggcattgctgttcct
gagaatccaaagcacgtgatgtatgtctgggttgatgcgcttacaaattatctatcagca
attggttttttcaatgaaaattcaaaaaaacgtgatttttggcctgcaaatacgcatatt
attggtaaggatattattcgttttcatgcagtctattggccggcatttttaatgtctgct
ggaattgaattgcctaaaaatatttttgcacatggttttttacttaatcgtggtgcaaaa
atgtcaaaatctattggaaatgtcgttgatccttttgaaatggttgatcattatggtctt
gatcaggtccgttattttcttctccgtgaagtaccattcggacaagatggtagttatagc
catgaaagccttgtgaaccgtattaatgctgatcttgctaatgatcttggtaatttagca
cagcgctgtttgtctatgattgccaaaaattgtaatgcacaagtcccgagaccaacttca
tttttagctcaagataaacagcttttagaacaatctcttcaagtacttgaaactgtacat
caagctatgtcttcttatagtatgcatttagcactttcagctattttttcaattgtagca
gatgccaaccgctattttgccaacgaacaaccttggagtttacgtaaaaatgaccaagag
cgattttctacagttctttatatcactgtagaaatcttgcggagaataggaattatgctt
ttacctttcataccccaatcagcagcgaaacttcttgatagccttgcggttgctgaagat
gatcggttgttgtatcatataagtcactcaaaaattcaagaagggcttgatcttccacca
ccagaaccgatttttcctcgttatatcttgaagaaagaagatacttatcatgttgattga

DBGET integrated database retrieval system