KEGG   Bartonella grahamii: Bgr_19150Help
Entry
Bgr_19150         CDS       T00922                                 

Gene name
trwL7
Definition
(GenBank) TrwL7 protein
Organism
bgr  Bartonella grahamii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: ACS52008
UniProt: C6AAR9
Position
2211209..2211529
Genome map
AA seq 106 aa AA seqDB search
MKKIINLKLKNNNKIIVISAAISAFFITQSAYANAKLGPAEKALNALQKDLIDNIIPVAA
AVILLCLAIGYAGRYIERDTFIRWAIGVVIAGSATQLAKLLFTGNA
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataattaatcttaaattaaaaaataataacaaaattattgtaatttctgca
gctataagcgccttttttataacacagtctgcatatgcaaatgcaaaattaggtcctgct
gaaaaagctctaaatgctctacaaaaagatcttattgataacattattcctgttgctgct
gctgttatacttctgtgcttagcaattggttacgcaggacgatacattgaaagagataca
tttatacggtgggcaattggtgttgtcatcgcaggttctgcaacccaacttgctaaactg
ctatttacaggtaatgcataa

DBGET integrated database retrieval system