KEGG   Bartonella grahamii: Bgr_19220Help
Entry
Bgr_19220         CDS       T00922                                 

Gene name
trwJ2
Definition
(GenBank) TrwJ2 protein
  KO
K03200  type IV secretion system protein VirB5
Organism
bgr  Bartonella grahamii
Pathway
bgr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bgr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bgr_19220 (trwJ2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bgr02044]
    Bgr_19220 (trwJ2)
Secretion system [BR:bgr02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Bgr_19220 (trwJ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS SbmA_BacA Borrelia_REV Palm_thioest
Motif
Other DBs
NCBI-ProteinID: ACS52015
UniProt: C6AAS6
Position
2216927..2217670
Genome map
AA seq 247 aa AA seqDB search
MRKILTITGMITLFGMINLTLTSNFSWGSTTQDSTVQIPFSKANYLEIIKLLKQQIEETK
KQIENAKKIHQSIIGPKIPPYTLGDTFSFFIPVSPFDYPDTKTNYQAIYVGHYRNLFRKL
VLEEKRDSFQKLPYYKIREIINTRLKYSGIIEKAVSLQTFKDIENRFKQVKDFLDKINNT
KDLKELFDLQTRIKTMSSMIQNEYTKLQMVRNLSDDEETLIEIQKRKLYSKIVASYNKRM
PEIRYNQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagattcttactataacaggaatgattaccctttttggaatgataaatttaact
ctaacgtctaactttagttggggttctacaactcaagattcaactgttcaaattcctttt
tcaaaagcaaactatctggaaattattaagttgttaaaacaacaaattgaagaaaccaaa
aagcagatcgaaaacgcgaaaaaaatccatcagtctataataggacctaaaataccacca
tatacactaggagacacttttagttttttcataccagtttcgccttttgactacccagac
acaaaaacaaactaccaagccatatatgttgggcactatagaaatctttttcgtaaactt
gttctcgaagagaaaagggacagcttccagaaattgccgtattataagatacgcgaaata
attaatacacgtcttaaatatagtggaattatcgaaaaagctgtaagtttacaaactttc
aaagacatagagaaccgctttaaacaagtgaaagatttcttagataagataaataacaca
aaagatctgaaagaactttttgatctacaaacacgcattaagaccatgtcatccatgatc
caaaatgaatatacaaagctacaaatggtcagaaatttaagcgatgacgaagagactctt
atcgaaatacaaaaacgtaaattgtatagcaaaattgtagcctcttacaacaaacgtatg
cctgaaataagatataaccaataa

DBGET integrated database retrieval system