KEGG   Bartonella grahamii: Bgr_19280Help
Entry
Bgr_19280         CDS       T00922                                 

Gene name
trwJ4
Definition
(GenBank) TrwJ4 protein
Organism
bgr  Bartonella grahamii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T4SS
Motif
Other DBs
NCBI-ProteinID: ACS52021
UniProt: C6AAT2
Position
2221351..2222295
Genome map
AA seq 314 aa AA seqDB search
MQKLIIIIAISAFLGTTNLVRSDTITKQGGAHSRIPIIPGMGSGGLSTSKDYKPEPPKGY
KPPSALPPDVKIDLSTLGTMRNRIPSKPSGSKPSNTTPVSPTTQVPKSTFVSAPPAEYLE
IINLLKKGEIIELLKKQLELKKEQLSQVEKAYQAITKSQKTEPQKIDFSSFFLKEPEALY
KSDKLSRESYQKVLEEENKIYGSFDQMGKAISGRLKFASILDKAVSLETFENVENRFKYL
QHLLDEIQTKENLKDTADLQAHIDGSLTMIQNEFIKMEMVAHLRNAEQSLIKRKRRELDM
KIFDHEAKRMPTIR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagctgattattatcatagcaattagtgcgtttcttggaacaacaaacttagta
agaagtgacactattactaagcaaggaggagctcatagccgtattcctataattcctggt
atggggtcaggaggtctcagtacaagcaaagattataaaccagaaccaccaaaaggctat
aagccaccatctgcacttccacccgatgttaaaatcgatctttctactttgggaacgatg
agaaatcgcataccgtccaaacctagtggctctaagccatctaacacaactccagtatct
cccacaactcaggtacctaaatcaacttttgtatctgctccacctgcagaatatctagag
attattaatctattaaaaaaaggggaaattattgagctgttaaaaaaacagcttgagttg
aaaaaagaacaactttcgcaagtagaaaaagcttatcaggctataacaaagagtcagaaa
acagaacctcaaaaaatagacttttctagtttttttctcaaagaaccagaagcgctctat
aagagtgataagctttcaagggaatcatatcaaaaggtattagaggaagaaaacaaaatt
tatgggtcttttgatcaaatgggcaaagctatttcggggcgcttaaaatttgcatcgata
ctagataaagctgtaagtttagaaacttttgaaaacgtagaaaatcgttttaaatacctc
caacatctattagatgaaattcaaacaaaagaaaacctgaaagatactgcagatcttcaa
gcacatatcgatggttcgttaaccatgatccaaaatgaatttataaagatggaaatggta
gcgcatttacgtaatgctgagcaatcacttatcaaaaggaaaagacgcgaacttgatatg
aaaatttttgaccatgaagcaaaaaggatgcctaccatacgataa

DBGET integrated database retrieval system