KEGG   Bartonella grahamii: Bgr_20140Help
Entry
Bgr_20140         CDS       T00922                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bgr  Bartonella grahamii
Pathway
bgr00020  Citrate cycle (TCA cycle)
bgr00640  Propanoate metabolism
bgr00660  C5-Branched dibasic acid metabolism
bgr01100  Metabolic pathways
bgr01110  Biosynthesis of secondary metabolites
bgr01120  Microbial metabolism in diverse environments
bgr01130  Biosynthesis of antibiotics
bgr01200  Carbon metabolism
Module
bgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bgr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bgr_20140 (sucC)
   00640 Propanoate metabolism
    Bgr_20140 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Bgr_20140 (sucC)
Enzymes [BR:bgr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bgr_20140 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACS52099
UniProt: C6AB10
Position
complement(2322532..2323728)
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKRLLHEYGAPIANGVAVYSVEQAEKWAEKLPGPLYVVKSQIHAGGRGKGKFK
ELGPDAKGGVRLAKSVEEVVANVQEMLGKTLVTKQTGPEGKQVNRLYIEDGADIERELYL
SLLVDRSVGRIAFVVSTEGGMDIETVAEETPEKIFTLPIDAVEGVTSVDCARLCDALKLQ
SSAREDGEKLFPILYKAFCEKDMSLLEINPLIVMKDGRLRVLDAKVSFDNNALFRHPDIL
ELRDLSEEDPKEIEASKHDLAYVALEGTIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGASKEKVTAAFKIITADPNVKGILVNIFGGIMRCDVIAEGVVAAVREVGLKVPLVVRLE
GTNVEQGKAIINESSLNVIPADNLDDAAQKIVAAVKGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtatcaggccaaacgtctgcttcatgaatatggagcaccaattgca
aatggtgttgctgtttattctgttgagcaagctgaaaaatgggcggaaaaattgcccgga
cctctctatgtggttaaaagtcagatacacgctggtggtcgtggtaagggtaagtttaaa
gaacttggtcctgatgcaaagggtggtgttcggcttgcaaaatctgttgaagaagttgtt
gcaaatgttcaagaaatgcttggtaaaactttggtaaccaaacaaacgggtccagagggt
aagcaggtcaatcgtctttacattgaggatggtgctgatattgaaagggagctttatctt
tcacttttggttgatcgtagcgttggtcgaattgcttttgttgtttcaacagaaggtgga
atggatattgaaacggttgctgaagagacaccagaaaaaatattcacgcttcccattgat
gctgtagagggtgttacttcggttgattgtgcaagactttgtgatgcattgaaactacaa
agtagtgcgcgagaagatggtgaaaagctttttccgattctctataaggcattttgtgaa
aaagatatgagccttttagaaatcaatccgcttattgtgatgaaagatggtcgtttacgt
gttcttgatgcaaaagtttcttttgataataatgctctgtttcgtcatccagatatttta
gaattacgcgatctttcagaagaggatccaaaagaaattgaagcatcaaagcatgatctt
gcttatgttgctcttgagggtacaattggctgcatggttaatggtgcgggtcttgctatg
gcaacaatggatattatcaaactctatggagctgagcctgcaaattttcttgacgttggt
ggtggagcgtcaaaagaaaaggtgacagctgcttttaaaattattacggccgatccaaat
gttaagggcattttggttaacatttttggtggtattatgcgttgtgatgtcattgctgaa
ggtgtggttgctgctgttcgtgaggttggtttaaaggttcccttagttgttcgtcttgaa
ggcactaatgttgagcagggtaaagcaattatcaatgaaagtagtttgaatgttattcct
gctgataatttagatgatgctgcccaaaaaattgttgcagccgtgaagggagcttaa

DBGET integrated database retrieval system