KEGG   Borreliella garinii SZ: X921_00010Help
Entry
X921_00010        CDS       T03259                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bgs  Borreliella garinii SZ
Pathway
bgs00220  Arginine biosynthesis
bgs01100  Metabolic pathways
bgs01110  Biosynthesis of secondary metabolites
bgs01130  Biosynthesis of antibiotics
bgs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bgs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    X921_00010
Enzymes [BR:bgs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     X921_00010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N PALP
Motif
Other DBs
NCBI-ProteinID: AHZ73725
Position
complement(1561..2544)
Genome map
AA seq 327 aa AA seqDB search
MYNLRNRSFLNLLDFTSKDIRYLLDLSIDLKKSKYAGIEVQKLKGKNMVIIFEKDSTRTR
CAFEIAAYDQGANITYLGSRGNQIGVKESMIDTARVLGRMYDAIGFRGFSQQTVECLANY
SNVPVYNGLTDTAHPTQILADLMTIEEHKGSLKGVKIVFCGDGRGNVANSLLKGCAIMGL
DFRIFAPKELFPDSNLTLKAKSLALDSGGKITITDSKEEAVKCADVVYTDVWVSMGENNW
EDRINLLRFYQVNKEIMDIAKDDAIFMHCLPAFHDLNTVVGKDIFDKYGINGIEVTEEIF
ESKNSVVFDVAENRVHTIKAIMVATLG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtataatttacgaaataggagctttttaaatcttttagattttacaagcaaagatatt
agatatttacttgatttatcgattgatttaaaaaaatcaaaatatgcaggaattgaagtg
cagaagcttaaaggtaaaaatatggttataattttcgagaaagattcaacaagaactcgg
tgtgcttttgagatcgcagcgtatgatcaaggggcaaatattacgtatttaggttctaga
ggcaatcaaataggcgtaaaagagtctatgatagataccgctagagttctagggcgtatg
tatgatgccattgggtttagagggttttctcaacagactgttgaatgtttagcgaattat
tctaatgttcctgtttacaatggattgacagatactgctcatccaacccaaatactagcc
gatttaatgacaatagaagagcataaaggaagtttaaaaggggttaaaatagtattttgt
ggcgatggtagagggaatgttgccaattctttattgaaaggctgtgctattatggggctc
gattttagaatttttgctcccaaagagctttttccagactcgaatttgacgcttaaggct
aagtctttagctctagatagtggaggtaaaattacaattacagattctaaagaagaggct
gtaaaatgcgctgatgttgtgtatacggatgtgtgggtatctatgggcgaaaataattgg
gaagatagaataaatcttctaaggttttatcaggtcaataaagagattatggatatagca
aaagatgatgcaatatttatgcattgtttacctgcttttcacgatttaaatactgtggtt
ggtaaagatatttttgataaatatggaattaatggaatcgaagttacagaagaaattttt
gaaagtaaaaattcagttgtttttgatgttgctgagaatagagtacacaccattaaagct
attatggtagcgactttaggataa

DBGET integrated database retrieval system