KEGG   Borreliella garinii SZ: X921_02460Help
Entry
X921_02460        CDS       T03259                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
bgs  Borreliella garinii SZ
Pathway
bgs00970  Aminoacyl-tRNA biosynthesis
bgs01100  Metabolic pathways
bgs01110  Biosynthesis of secondary metabolites
bgs01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bgs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    X921_02460
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    X921_02460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgs01007]
    X921_02460
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bgs03016]
    X921_02460
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:bgs02048]
    X921_02460
Enzymes [BR:bgs01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     X921_02460
Amino acid related enzymes [BR:bgs01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   X921_02460
Transfer RNA biogenesis [BR:bgs03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    X921_02460
 Prokaryotic Type
   Other AARSs
    X921_02460
Prokaryotic defense system [BR:bgs02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    X921_02460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AHZ74175
Position
520250..521722
Genome map
AA seq 490 aa AA seqDB search
MSIRVRYAPSPTGLQHIGGIRTALFNYFFAKSCGGKFLLRIEDTDQSRYFPEAENDLYSS
LKWLGISFDEGPIIGGDYAPYVQSQRSAIYKKYAKYLIESGHAYYCYCSPERLERIKKIQ
NINKMPPGYDRHCRNLSDDEVENALIKKIKPVVRFKIPLEGETSFDDILLGKITWSNKDI
SPDPVILKSDGLPTYHLANVVDDYLMKITHVLRSQEWVSSGPLHILLYKAFEWKSPIYCH
LPMVMGNDGQKLSKRHGSTALRQFIEDGYLPEAIINYVTLLGWSYDDKREFFSKNDLEQF
FSIEKINKSSAIFDYHKLDFFNSYYIREKKDEDLYNLLLPFFQKKGYVSELITLEEGQKL
KLLIPLIKNRIKKLSDALNMTKFFYEDIKSWNLDEFLNRKKTAKEVCHILELTKPILEGF
EKRSSEENDKIFYDFADNNGFKLGEILLPIRIAALGSKVSPPLFDSLKLIGKSKVFERIK
LAQEFLRINE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
ttgagtataagagttcgttatgcgccttctccaacgggcttgcaacatattggcgggatt
agaacggctttgtttaattatttttttgcaaagtcttgtgggggtaaatttttacttaga
attgaggatacagatcagagcagatattttccagaagctgaaaatgatctttattcaagc
cttaaatggcttggtatttcttttgatgaaggtcctattatagggggtgattatgcacct
tatgttcagtctcaaagaagtgcaatatataaaaaatatgctaaatatttaattgaatct
gggcatgcttattattgctattgcagtcctgaaaggttggaaagaattaagaaaattcaa
aatattaataagatgccacctggatatgataggcattgtagaaatttaagtgatgacgaa
gttgagaatgcactaattaaaaaaatcaagcctgttgttagatttaaaattcctttagaa
ggagagaccagctttgatgatattttgcttggtaagattacatggtcgaataaagacatt
agtcctgatcctgtaattctaaagtcagatggattgccgacttaccatcttgcgaatgtt
gttgatgattatttaatgaaaattacccatgtattaaggtctcaagaatgggtttcttca
ggtccattgcacatacttctttataaggcttttgaatggaagtcgcctatttattgtcat
cttccaatggttatgggaaatgatggtcaaaaattaagcaaaagacatggatcaacagct
ttaaggcagtttattgaagatggatatcttcctgaagctattattaattatgttactttg
cttggttggtcttacgatgataagagagaatttttttcaaaaaatgaccttgagcaattt
ttttcaattgaaaagatcaataaatcttctgcaattttcgattatcataagttagatttt
ttcaatagttactatattagagaaaaaaaagatgaagatttatataatcttttactccct
ttttttcaaaaaaaagggtatgtttctgagcttattactttagaagagggtcaaaaatta
aaattattaatccctcttataaagaatagaattaaaaaactaagtgatgctttaaatatg
actaaatttttttatgaggacattaaatcttggaatttagatgagtttttaaatagaaaa
aaaacagctaaagaggtttgtcatattttagaattaacaaagcctattttagaaggattt
gaaaaaagatcatcagaggaaaatgataaaattttttatgattttgctgataacaatggt
tttaaattgggagaaattcttcttcctattagaattgcagcacttggtagcaaagtctct
ccgccgctttttgattctttaaaattgataggtaagtctaaggtttttgaaagaataaaa
ttggcacaggaatttttaagaataaatgaataa

DBGET integrated database retrieval system