KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_1368Help
Entry
KS03_1368         CDS       T03820                                 

Gene name
apaG
Definition
(GenBank) protein ApaG
  KO
K06195  ApaG protein
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    KS03_1368 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: AJY66433
Position
I:1482650..1483024
Genome map
AA seq 124 aa AA seqDB search
MSQYEFSVSVKTAYLPEQSDPERRQYAFAYTLTIRNTGQVAAQLIARHWVITDSEQQVQE
VKGLGVVGHQPLLKPGEQFEYTSWAVIATPVGSMRGAYFCVAEDGERFDAPVAEFALHMP
RTLH
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtacgaattcagcgtgtcggtgaaaacagcttatctgccggaacaatccgac
ccggagcggcgtcaatatgcattcgcctacacgctgacgattcgcaataccggccaggtg
gcggcgcagctgatcgcgcggcactgggtgatcaccgacagcgaacagcaggtgcaggaa
gtgaagggactcggcgtggtcggccatcagccgctcctgaagccgggcgagcaatttgaa
tacacgagctgggcggtgatcgcgacgccggtgggcagcatgcgcggcgcttacttctgc
gtggccgaggacggcgagcgcttcgacgcgccggtcgccgaattcgcgctgcacatgccg
cgcacgctgcactga

DBGET integrated database retrieval system