KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_2248Help
Entry
KS03_2248         CDS       T03820                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00540  Lipopolysaccharide biosynthesis
bgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    KS03_2248 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bgu01003]
    KS03_2248 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:bgu01005]
    KS03_2248 (lpxB)
Enzymes [BR:bgu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     KS03_2248 (lpxB)
Glycosyltransferases [BR:bgu01003]
 Polysaccharide
  Bacterial polysaccharide
   KS03_2248 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:bgu01005]
 Lipid A
  KS03_2248 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB Epimerase_2
Motif
Other DBs
NCBI-ProteinID: AJY66787
Position
I:2457940..2459109
Genome map
AA seq 389 aa AA seqDB search
MALPPKPLRIALAAGEPSGDLLAASLLGGLHARLPAASHYYGIGGPRMISAGFESHWPMD
RLTVRGYVEALKEIPAILRIRGELKRQLLTEPPDAFIGVDAPDFNFGVEQALREAGIPTV
HFVCPSIWAWRGGRIKKIVKSVDHMLCLFPFEPALLEKSGVASTYVGHPLADEIPLEPDT
HGARIALGLPEHGPVIAVLPGSRRSEIALIGPTFFAAMALMHQREPGLRFVMPAATPALR
ALLQPLVDAHPQLPLTLTDGRSQVAMTAADAILVKSGTVTLEAALLKKPMVISYKVPWLT
GQIMRRQGYQPYVGLPNILAGRFVVPELLQHFATPQALADATLTQLRDDANRRTLTEIFT
QLHLSLRQNTAVRAAEAVERVIASRKPRA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcccaccgaaaccgttgcgaatcgcgctcgcggccggcgagccgtcgggcgac
ctgctggccgcgtcgctgctgggcggcctgcacgcacggttgccggcggcgtcgcactat
tacggcatcggcggcccgcgcatgatctcggccggcttcgaatcgcactggccgatggac
cggctgacggtgcgcggctatgtcgaggcgctcaaggaaatcccggcgatcctgcggatc
cgcggcgagctgaagcgccagctgctgaccgagccgcccgatgcgttcatcggcgtcgac
gcgcccgatttcaatttcggcgtcgagcaggcactgcgcgaggccggcatcccgaccgtc
cacttcgtctgcccgtcgatctgggcatggcgcggcgggcgcatcaagaagatcgtgaag
tcggtcgatcacatgctgtgcctgttcccgttcgagccggcgctgctcgaaaaatcgggc
gtggcctcgacctacgtcggccatccgctcgccgacgagatcccgctcgaacccgacacg
cacggtgcgcgcatcgcgctcgggctgcccgagcacggtcccgtgatcgcggtgctgccc
ggcagccggcgttcggagatcgcgctgatcgggccgaccttcttcgccgcgatggcgctg
atgcaccagcgcgagcccggcctgcgcttcgtgatgccggccgcgacgccggccctgcgc
gcgctgctgcagccgctcgtcgacgcgcatccgcaactgccgctcacgctgaccgacggc
cgctcgcaggtggcgatgacggctgccgacgcgattctcgtcaagagcgggacggtgacg
ctcgaggccgcgctgctgaagaagccgatggtgatctcgtacaaggtgccctggctgacg
gggcagatcatgcgccggcaaggctaccagccctatgtcgggctgccgaacatcctggcc
ggccgcttcgtggtgccggaactgctgcagcacttcgcgaccccgcaggcgttggccgac
gcgacgctcacgcagctgcgcgacgacgcgaaccgccgcacgctgaccgaaatcttcacg
cagctgcatctgtcgctgcgtcagaacaccgccgtgcgcgccgcggaggcggtcgagcgc
gtgatcgcgagccggaagccacgcgcatga

DBGET integrated database retrieval system