KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_2295Help
Entry
KS03_2295         CDS       T03820                                 

Definition
(GenBank) hypothetical protein
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KS03_2295
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bgu02022]
    KS03_2295
Two-component system [BR:bgu02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   KS03_2295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF43
Motif
Other DBs
NCBI-ProteinID: AJY68007
Position
I:complement(2513294..2514019)
Genome map
AA seq 241 aa AA seqDB search
METKNPSKILVVDDDPRLRDLLRRYLGEQGFNVYVAENATAMNKLWVRERFDLLVLDLML
PGEDGLSICRRLRGSNDRTPIIMLTAKGEDVDRIVGLEMGADDYLPKPFNPRELVARIHA
VLRRQAPAELPGAPSETTEVFEFGEFSLNLATRTLTKSGQEIPLTTGEFSVLKVFARHPR
QPLSREKLMELARGREYEVFDRSLDVQISRLRKLIEPDPGSPRFIQTVWGLGYVFIPDGA
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaaaatccctcgaaaattctcgtcgtggacgacgatccccgcctgcgcgat
ctgctgcgccgctatctgggcgaacagggcttcaacgtctacgtcgcggaaaacgcgacc
gccatgaacaagctctgggtgcgcgagcgcttcgacctgctcgtgctcgacctgatgctg
cccggcgaggatggcctgtcgatctgccgccggctgcgcggcagcaacgatcgcacgccg
atcatcatgctcacggccaagggcgaggatgtcgatcgcatcgtcggcctcgaaatgggc
gcggacgattacctgcccaagccattcaatccgcgcgagctggtcgcgcggattcacgcg
gtgctgcgccgccaggcaccggccgaactgccgggcgcgccgtccgagaccaccgaggtg
ttcgagttcggcgagttctcgctgaatctggccacgcgcacgctgacgaagtcgggccag
gagatccccctgaccaccggcgaattctcggtgctgaaggtgtttgcgcgccatcctcgc
cagccgctgtctcgtgaaaagctgatggagctggcgcgcgggcgtgaatacgaagtgttc
gaccgcagcctcgacgtgcagatctcgcggctgcgcaagctgatcgagcccgatccgggc
agcccgcgcttcattcagaccgtctggggcctcggctacgtcttcatcccggacggcgcc
gcctga

DBGET integrated database retrieval system