KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_2489Help
Entry
KS03_2489         CDS       T03820                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00071  Fatty acid degradation
bgu00072  Synthesis and degradation of ketone bodies
bgu00280  Valine, leucine and isoleucine degradation
bgu00310  Lysine degradation
bgu00362  Benzoate degradation
bgu00380  Tryptophan metabolism
bgu00620  Pyruvate metabolism
bgu00630  Glyoxylate and dicarboxylate metabolism
bgu00640  Propanoate metabolism
bgu00650  Butanoate metabolism
bgu00900  Terpenoid backbone biosynthesis
bgu01100  Metabolic pathways
bgu01110  Biosynthesis of secondary metabolites
bgu01120  Microbial metabolism in diverse environments
bgu01130  Biosynthesis of antibiotics
bgu01200  Carbon metabolism
bgu01212  Fatty acid metabolism
bgu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KS03_2489
   00630 Glyoxylate and dicarboxylate metabolism
    KS03_2489
   00640 Propanoate metabolism
    KS03_2489
   00650 Butanoate metabolism
    KS03_2489
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KS03_2489
   00072 Synthesis and degradation of ketone bodies
    KS03_2489
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KS03_2489
   00310 Lysine degradation
    KS03_2489
   00380 Tryptophan metabolism
    KS03_2489
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KS03_2489
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KS03_2489
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KS03_2489
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgu04147]
    KS03_2489
Enzymes [BR:bgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KS03_2489
Exosome [BR:bgu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KS03_2489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AJY66998
Position
I:2730997..2732181
Genome map
AA seq 394 aa AA seqDB search
MQREVVVVSGVRTAIGDFGGSLKDFAPTELGARVVREAMARAGVAGDEVGHVVFGNVVHT
EPKDMYLARVAAIDGGVSQHAPALTVNRLCGSGLQAIVSAAQSVLLGDAEIAVAGGAESM
SRAPYTLPAARFGQRMGDARAVDMMLGALNDPFQAIHMGMTAENVAAKYGITREAQDALA
LESHRRASHATKAGYFKTQILPIEIGSKRGTVSFDTDEHVRHDAAAEDFAKLRPVFAKEN
GTVTAGNASGINDAAAAVTLMERRVAEARGLKPLARLVAYAHAGVDPAYMGIGPVPASKK
ALERAGIGVADLDVIEANEAFAAQACAVANELGFDPEKVNPNGSGISLGHPIGATGALIT
VKALYELHRISGRYALVTMCIGGGQGIAAVFERI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgcgaagtggtggtggtcagcggagtacgcaccgcgatcggcgatttcggcggc
agcctgaaggatttcgcgccgaccgagcttggcgcgcgcgtggtgcgcgaggcgatggcg
cgcgcgggcgtggcgggcgacgaggtcgggcacgtggtgttcggcaacgtggtccatacg
gagccgaaggacatgtatctggcgcgcgtggcggcgatcgacggcggcgtctcgcagcac
gcgccggcgctgacggtgaaccggctgtgcggctcggggctgcaggcgatcgtctcggcg
gcgcagagcgtgctgctcggcgacgccgagatcgcggtggcgggcggcgcggaaagcatg
agccgcgcgccgtacacgctgccggcggcgcgcttcgggcagcgcatgggcgatgcgcgg
gcggtcgacatgatgctcggcgccctcaacgatccgttccaggcgatccacatgggcatg
acggccgagaacgtggcggcgaagtacggcatcacgcgcgaggcgcaggacgcgctcgcg
ctcgaatcgcaccggcgcgcctcgcacgcgaccaaggccggctacttcaagacccagatc
ctgccgatcgagatcggctcgaagcgcggcaccgtcagcttcgacaccgacgagcacgtg
cgccacgacgcggcggcggaggatttcgccaagctgcgcccggtgttcgcgaaggagaac
ggcacggtcacggccggcaatgcgtcgggcatcaacgacgcggcggcggccgtgacgctg
atggagcggcgcgtggccgaggcgcgcggcctgaagccgctggcgcggctggtggcctac
gcgcacgcgggcgtcgatccggcctacatgggcatcggcccggtgccggcctcgaagaag
gcgctcgagcgcgccggcatcggcgtggccgatctcgacgtgatcgaggcgaacgaggcg
ttcgcggcgcaggcctgcgcggtggccaacgagctgggcttcgatcccgagaaggtgaat
ccgaacggctcgggcatctcgctcggccatccgatcggtgcgacgggcgcgctgatcacc
gtcaaggcgctctacgaactgcatcggatctcgggccgctatgcgctggtgacgatgtgc
atcggcggcggccagggcattgccgccgtgttcgaacgtatctga

DBGET integrated database retrieval system