KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_4724Help
Entry
KS03_4724         CDS       T03820                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00030  Pentose phosphate pathway
bgu00480  Glutathione metabolism
bgu01100  Metabolic pathways
bgu01110  Biosynthesis of secondary metabolites
bgu01120  Microbial metabolism in diverse environments
bgu01130  Biosynthesis of antibiotics
bgu01200  Carbon metabolism
Module
bgu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bgu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
bgu_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KS03_4724 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KS03_4724 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgu04147]
    KS03_4724 (zwf)
Enzymes [BR:bgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     KS03_4724 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     KS03_4724 (zwf)
Exosome [BR:bgu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   KS03_4724 (zwf)
  Exosomal proteins of colorectal cancer cells
   KS03_4724 (zwf)
  Exosomal proteins of bladder cancer cells
   KS03_4724 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AJY64807
Position
II:1665676..1667373
Genome map
AA seq 565 aa AA seqDB search
MPLNDATRAPSDQARQPAGAKVPAPSRGAPAAPAGRHPAPPCTLVIFGAGGDLTSRLLMP
ALYNLAADGLLDEGTKIIGVNHGERETEAWRDDLHSALQKLAADKASTFHAGKLDEHAWR
WVAQRLQYLAGDFEDEGTYRRLAQQLGAGGPGAAHGSVAFYLAVSGRFFKPIVERLGKAG
LLEQAGDGGPFRRVVIEKPFGTDLASARDLNRHLLGFMKESQIYRIDHFLGKETVQSILA
VRFANALFEPIWRREYIDSVQIAASEVIGVERRGSFYEQTGAFRDMVPNHLFQLLGMVAM
EPPNSFDARAVRDKKAEVFDALKPLAPRDVVFGQYAAGPGGAAYRDEPDVAPDSTTETYA
AARVQIDNWRWAGVPFYLRTGKRLAERRTEIAVQLKPVPFRLFRDTPTDALTPNVLTLRI
DPSHGTSFDFNVKTPGPVMRVGAVRSSFDYDAFFPERANVGYETLLYDCLLGDETLFQRA
DSIESTWQAAEGVLHPRDGAAIPVQAYPAGSEGPAEAAALIERDGRAWRPLAARQAGAEA
QAKAASHSASKPKPKPKPQADAGKP
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcaacgatgccacccgcgccccctccgaccaagcgcgccagccggccggcgcg
aaggtgcccgcgccgtcgcgcggcgcgcccgcggcgccggccggccggcaccccgcgccg
ccctgcacgctggtgatcttcggcgccggcggtgacctgacgagccggctgctgatgccc
gcgctctacaacctcgcggcggacggcctgctcgacgagggcacgaagatcatcggcgtc
aatcacggcgagcgcgagaccgaggcctggcgcgacgatttacacagcgcattgcaaaag
ctcgccgccgacaaggccagcacctttcacgccggcaagctcgacgagcacgcctggcgc
tgggtcgcgcagcgcctgcaatacctggccggcgacttcgaggacgagggcacctaccgg
cgtctcgcgcagcagctcggcgcaggcgggcccggcgccgcgcacggcagcgtggcgttc
tacctcgcggtgagcgggcgcttcttcaagccgatcgtcgagcgcctgggcaaggccggc
ctgctcgagcaagccggcgacggcgggccgttccgccgcgtggtgatcgaaaagccgttc
ggcaccgatctggcctcggcacgcgacctgaaccggcacctgctcggcttcatgaaggaa
tcgcagatctaccggatcgaccacttcctcggcaaggagacggtgcagagcatcctggcc
gtgcgcttcgccaacgcgctgttcgagccgatctggcggcgcgagtacatcgacagcgtg
cagatcgcggcttccgaggtgatcggcgtcgagcgccgcggcagcttctacgagcagacc
ggcgcgttccgcgacatggtgccgaaccatctgttccaactgctcggcatggtcgcgatg
gagccgccgaactcgttcgacgcgcgggccgtgcgcgacaagaaggccgaggtcttcgac
gcgctgaagccgctcgcgccgcgcgacgtggtgttcggccagtacgcggcggggccgggc
ggtgcggcctatcgcgacgagcccgacgtggcgcccgacagcacgaccgagacctacgcg
gcggcgcgcgtgcagatcgacaactggcgctgggccggcgtgccgttctacctgcgcacc
ggcaagcggctggccgagcggcgcaccgaaatcgccgtgcagctgaaaccggtgccgttc
cggctgttccgcgacacgcccaccgacgccctgacgccgaacgtgctgacgctgcgcatc
gacccctcgcacggcaccagcttcgatttcaacgtgaagacgccggggccggtcatgcgg
gtcggcgcggtgcgctcgtcgttcgattacgatgcgtttttccccgagcgcgccaacgtc
ggctacgagacgctgctctacgattgcctgctcggcgacgagacgctgttccagcgcgcc
gacagcatcgaatcgacttggcaggccgccgagggcgtgctgcacccgcgtgacggcgcc
gcgatcccggtgcaggcttacccggccggcagcgaggggccggccgaggccgccgcgctg
atcgagcgcgacgggcgcgcgtggcggccgctcgcggcgcggcaggcaggggccgaagcg
caggcgaaggcggcgtcgcattccgcttcgaagccgaagccgaagccgaagccgcaggcg
gacgccggcaagccgtga

DBGET integrated database retrieval system