KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_5342Help
Entry
KS03_5342         CDS       T03820                                 

Definition
(GenBank) HMGL-like family protein
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00360  Phenylalanine metabolism
bgu00362  Benzoate degradation
bgu00621  Dioxin degradation
bgu00622  Xylene degradation
bgu01100  Metabolic pathways
bgu01120  Microbial metabolism in diverse environments
bgu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    KS03_5342
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KS03_5342
   00622 Xylene degradation
    KS03_5342
   00621 Dioxin degradation
    KS03_5342
Enzymes [BR:bgu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     KS03_5342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: AJY64021
Position
II:complement(2503445..2504362)
Genome map
AA seq 305 aa AA seqDB search
MTLLSNQAHCARAVTLLDCTLRDGGYLNGHDFSAPQIDAILTRLLASGVDVIEVGYFRRR
NVERHPSTVIARCPPAFLASLARTQAVRYAVMVPPGDAEPADLDELAELPVSVVRFTCTD
QNLPKVLALGERAARLGLVVCANITRVSERSHSQLAALTRALAEAGFDTVYAADSNGALY
PDEVAAIVGEMRRHFTGQIGFHAHDSLHLAFANALAAMRAGASWVDGTIGGVGKGGGNAA
IEVLLSELAKADSRPIDIAGFSQMPASFPHDFFPVRFKERLDNVFYGRNNLNIDKIKSLE
SRPSH
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgctgtcgaatcaggcgcattgcgcgcgcgccgtcacgctgctcgactgcacc
ctgcgggacggcggttacctcaatggccatgatttttccgcgccgcagatcgacgcgatc
ctgacgcggctgctcgcctcgggcgtggatgtgatcgaggtcggctatttccggcggcgc
aacgtcgaacggcacccgtccacggttatcgcacgctgcccgcccgccttcctcgcttcg
ctggcgcgcacgcaagctgtccgctatgcggtgatggtgccgcccggcgacgccgagccg
gccgatctcgacgaactcgccgagttgccggtctcggtggtccgcttcacctgcaccgac
cagaacctgccgaaggtgctcgcgctcggcgagcgcgccgcgcggctcggtctcgtggtc
tgcgccaacatcacgcgggtgagcgagcgctcgcactcgcagctcgccgcgctcacgcgc
gccctggccgaggccggcttcgacacggtctacgcggccgattcgaacggcgcgctctac
ccggacgaggtcgccgcgatcgtcggcgagatgcgccgtcatttcaccggccagatcggc
tttcatgcgcacgactcgctgcatctggcgttcgcgaacgccctggccgcgatgcgcgcg
ggcgcgtcgtgggtcgacggcacgatcggcggagtcggcaagggtggcggcaacgcggcg
atcgaggtgctgctctcggagctcgcgaaggccgattcacggccgatcgacatcgccgga
ttctcgcagatgccggcgagctttccgcacgacttctttccggtgcgtttcaaggagcgc
ctcgacaacgtcttttacggccgcaacaacctgaacatcgacaagatcaagtccctcgag
tcccgaccctcccactga

DBGET integrated database retrieval system