KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_5516Help
Entry
KS03_5516         CDS       T03820                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    KS03_5516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 TctB
Motif
Other DBs
NCBI-ProteinID: AJY64290
Position
II:2715628..2717208
Genome map
AA seq 526 aa AA seqDB search
MNQSALPTADAGRSRRFGQLVFLAVLVVGGAYVLTHLMADLAPVGEPSVFPYVLLGIALL
IALGFEFVNGFHDTANAVATVIYTHSLAPNVAVVWSGLWNFAGVLLSSGAVAFGILQLLP
VELILQVGSGAGFAMVFALLIAAIVWNLTTWYFGLPSSSSHTLIGSIIGVGVMNQLMHGA
SGTSGVDWSQALGVGKSLLFSPIVGFVLSGLLLLLLKGLVKLPQLYREPPKDKTPPFWIR
CLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAFALNKAVTPAESQTFIAVAHQAA
ATFGKYTNGAAAPSNSRRVVETYLQTHRMTPDTVPAVQQLSNSLAAAVGSTGSIASTPQG
DVDNLRNTMYLVSEAIRLMDKAGQPAFSADDRAAINNYRAQLDHATKFIPTWVKVAVALA
LGLGTMVGWRRIVVTVGEKIGKQHLTYGQGASAEVVAMVTIGAADMYGLPVSTTHVLSSG
VAGTMAANGSGLQWSTVRSLVLAWLLTLPASIVLAGALYWVFHALL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaatccgcgttacccaccgcagatgccggccgctcacggcgattcggccagctg
gtctttctcgccgtgctcgtcgtcggcggcgcgtatgtgctcactcatctgatggccgat
ctcgcgccggtcggcgagccttcggtgttcccctacgtgctgctcggcatcgcgctgctg
atcgcgctcggcttcgagttcgtcaacggcttccacgacacggccaatgcggtcgccacc
gtgatctacacccattcgctggcgccgaacgtggccgtggtctggtccggactctggaac
ttcgcgggcgtgctgctctcgagcggcgccgtggccttcggcatcctgcagttgctgccg
gtggagctgatcctgcaggtcggcagcggcgccggcttcgcgatggtgttcgcgctgctg
atcgcggcgatcgtctggaacctcacgacctggtacttcggcctgccctcgtctagctcg
cacacgctgatcggctcgatcatcggcgtcggcgtgatgaaccagctcatgcacggcgcc
tcgggcacgagcggcgtggactggagccaggcgctcggggtcggcaaatcgctgctgttc
tcgccgatcgtcggcttcgtgctctccggcctgctgctgcttctgctcaaggggctcgtg
aagctgccgcagctctatcgggaaccgccgaaggacaagacgccgccgttctggattcgc
tgcctgctgatcctgacctgcaccggcgtatcgttcgcgcacggctcgaacgacggccag
aagggcatggggctgatcatgctgatcctgatcggcacggtgcccaccgccttcgcgctg
aacaaggcggtcacgccggccgaatcgcagacctttatcgccgtcgcgcatcaggcggcc
gcgaccttcggcaagtacaccaacggcgccgcggcgcccagcaactcgcgccgcgtggtc
gagacctacctgcagacgcaccggatgacgccggacaccgtgcccgccgtgcagcagttg
tcgaactcgctcgcggccgcggtcggctcgaccggctcgatcgcgagcacgccgcagggc
gacgtcgacaacctgcgcaacaccatgtacctcgtgtcggaggcgatccgcctgatggac
aaggccgggcagccggccttctcggccgacgatcgggccgcgatcaacaactatcgcgcg
cagctcgaccacgccaccaagttcatcccgacctgggtcaaggtcgccgtcgcgctcgcg
ctcggcctcggcacgatggtgggctggaggcggatcgtggtcaccgtgggcgagaagatc
ggcaagcagcatctgacctacggccagggcgcctcggccgaagtcgtcgcgatggtcacg
atcggcgcggccgacatgtacgggctgccggtctcgaccacccatgtgctgtcgtcgggc
gtggcaggcacgatggccgccaacggctcgggcctgcaatggtcgaccgtgcgcagcctg
gtgctggcctggctgctgacgctgccggcctcgatcgtgctggccggcgcgctctactgg
gtgttccacgcgctgctctga

DBGET integrated database retrieval system