KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_610Help
Entry
KS03_610          CDS       T03820                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00520  Amino sugar and nucleotide sugar metabolism
bgu01100  Metabolic pathways
bgu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    KS03_610 (nagA)
Enzymes [BR:bgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     KS03_610 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AJY67295
Position
I:complement(669945..671048)
Genome map
AA seq 367 aa AA seqDB search
MLTGNLLTAEGWRYGTIEFGNGRITALSGHAVDPSMNDAPYIVPGFIDLHVHGGGGADVM
EGGDAIETIGRTHARYGTTSLLATTMTAPRDELMKVVAQLGERARNRTPGCARVLGVHLE
GPYINPGKLGAQPDAAVSAALDEVLRYLAIAPIRVVTLAPEIAGHIEIISEMAARGVRVQ
LGHSLATYEEGVAALKHGACGFTHLFNAMSPLHHRNPGLVGAALAHAEYAEIIPDLLHVH
PGAIRAALRAIPRLYVVTDSTSATGMPDGEYRLGSQHVTKCLGGVRLADGTLAGSTLTMD
QAFRNLVSIGLPIADVSNRMSRFAADYLGLEDRGRLARGAWADIAVFDRDLNLSATYVEG
ESIVEYA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccggaaacctactgaccgccgaaggctggcgctacggcacgatcgagttcggc
aacggccggatcaccgcgctgtcgggccatgccgtcgacccgtcgatgaacgacgcgccg
tacatcgtgccgggcttcatcgacctgcacgtgcatggcggcggcggagccgacgtgatg
gagggcggcgacgcgatcgagaccatcggccggacccacgcccgctacggcaccaccagc
ctgctcgccaccaccatgacggcgccgcgcgacgaactgatgaaggtggtcgcgcagctc
ggcgagcgcgcgcgcaaccgcacgccgggctgcgcgcgcgtgctcggcgtccatctcgaa
ggcccttacatcaaccccggcaagctcggcgcgcagcccgacgcggcggtatcggccgcg
ctcgacgaggtgctgcgctatctcgcgatcgcgccgatccgcgtggtcacgctcgcgccc
gagatcgccggccacatcgagatcatctcggagatggccgcgcgcggcgtgcgcgtgcag
ctcggccattcgctcgccacctatgaggagggcgtcgccgcgctcaagcatggcgcctgc
ggcttcacgcacctgttcaacgcgatgtcgccgctgcaccaccgcaaccccggtctggtc
ggcgccgcgctcgcccatgccgagtacgcggagatcatccccgacctgctgcacgtccat
cccggtgcgatccgcgccgcgctgcgcgcgatcccgcgcctgtacgtggtgaccgacagc
acctcggccaccggcatgcccgacggcgaataccggctcggcagccagcacgtcaccaag
tgtctcggcggcgtgcggctggccgacggcacgctggccggcagcacgctgacgatggac
caggcgttccgcaacctggtgtcgatcgggctgccgatcgccgacgtatcgaaccggatg
tcgcgcttcgccgccgactatctcggcctcgaggatcgcggccgcctcgcgcgcggcgcc
tgggccgacatcgccgtgttcgaccgcgacctgaacctgagcgcgacctacgtcgaagga
gaatcgattgtcgaatatgcttga

DBGET integrated database retrieval system