KEGG   Burkholderia glumae LMG 2196 = ATCC 33617: KS03_703Help
Entry
KS03_703          CDS       T03820                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bgu  Burkholderia glumae LMG 2196 = ATCC 33617
Pathway
bgu00780  Biotin metabolism
bgu01100  Metabolic pathways
Module
bgu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:bgu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    KS03_703 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgu01007]
    KS03_703 (bioF)
Enzymes [BR:bgu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     KS03_703 (bioF)
Amino acid related enzymes [BR:bgu01007]
 Aminotransferase (transaminase)
  Class II
   KS03_703 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AJY67116
Position
I:770830..772032
Genome map
AA seq 400 aa AA seqDB search
MSPPPNLLAALERGLAEIDAQGLRRVRRTADTACGAHMTVDGREIVGFASNDYLGLAAHP
ALVEAFAEGARRYGSGSGGSHLLGGHSRAHAALEDALAEFAGGFSRAPRALYFSTGYMAN
LAALSALVGRGAAIFSDSLNHASLIDGARLSRAEIHVYPHGDMDALSVQLAASDATVKLI
VSDTVFSMDGTIAPLARLVTLAEAHGAWLVVDDAHGFGVLGPQGRGALAEYALRSEQLIY
VGTLGKAAGVAGAFVIAHETVIEWMIQRARSYIFTTAAPPSVAHAVSASLAVIGGAEGDA
RRAHLAALIERTRAILRGTRWQPIDSATAVQPLVIGENDATLAAMRALDAHGLWVPAIRP
PTVPAGTSRLRISLSAAHSFDDLARLDAALAAAGAAEAAA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgccgccgaacctgctggccgcgctcgaacgcggcctggccgagatcgacgcc
cagggcctgcgccgcgtgcgccgcaccgccgacaccgcgtgcggcgcgcacatgacggtg
gacggccgcgagatcgtcggcttcgccagcaacgactacctgggcctcgccgcgcatccg
gcgctcgtcgaggcgttcgccgagggcgcgcggcgctacggctccggcagcggcggctcg
cacctgctgggcggccattcgcgcgcgcacgccgcgctcgaggacgcgctcgccgagttc
gccggcggcttcagccgcgcgccgcgcgcgctctacttcagcaccggctacatggcgaac
ctcgccgcgctgagcgccctggtggggcgcggtgcggcgatcttctccgattcgctgaac
cacgcctcgctgatcgacggcgcgcggctctcgcgcgccgagatccacgtctatccgcac
ggcgacatggacgcgctgtcggtgcagctggccgcctccgacgccaccgtcaagctgatc
gtctccgacaccgtgttcagcatggacggcaccatcgcgccgctggcacggctcgtcacg
ctggccgaggcgcatggcgcctggctggtggtggacgacgcgcacggcttcggcgtgctc
ggcccgcaggggcgcggcgcgctggccgagtacgcgctgcgctccgagcagctgatctac
gtgggcacgctcggcaaggccgccggcgtggccggcgcgttcgtgatcgcgcacgagacc
gtgatcgagtggatgatccagcgcgcgcgcagctacatcttcaccaccgccgcgccgccc
tcggtcgcgcacgccgtgtcggccagcctggccgtgatcggcggcgccgagggcgacgcg
cggcgcgcccacctggccgcgctgatcgagcgcacgcgcgcgatcctgcgcggcacgcgc
tggcagccgatcgattcggccaccgccgtacagccgctcgtgatcggcgagaacgacgcc
accctggccgcgatgcgcgcgctcgacgcgcacggcctgtgggtgcccgcgatccggccg
cccaccgtgccggccggcacctcgcggctgcgcatctcgctgtccgccgcgcattcgttc
gacgatctggcgcggctcgacgcggcgctcgccgccgccggcgccgcggaggccgccgca
tga

DBGET integrated database retrieval system